KEGG   Nanorana parkeri: 108785209Help
Entry
108785209         CDS       T04897                                 

Gene name
B3GALT1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
npr  Nanorana parkeri
Pathway
npr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
npr01100  Metabolic pathways
Module
npr_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108785209 (B3GALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:npr01003]
    108785209 (B3GALT1)
Enzymes [BR:npr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     108785209 (B3GALT1)
Glycosyltransferases [BR:npr01003]
 Glycan extension
  Type 1 chain
   108785209 (B3GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T CLPTM1
Motif
Other DBs
NCBI-GeneID: 108785209
NCBI-ProteinID: XP_018409750
LinkDB All DBs
Position
Unknown
AA seq 326 aa AA seqDB search
MASKVSCLYILTVVCWASALWYLSVTRPTSNYSGYKLSKVVLAQKNITFGNIRTRPINPH
SFEFVINEPEKCENNGSPFLVILISTTHKEFDARQAIRETWGNESNFKGIKIVTLFLLGK
NADPVLNQMVEQESQIFHDIVVEDFIDSYHNLTLKTMMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPTTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQIGPEEMHRIWNDMQSKKHLRC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaaggtgtcatgtctgtatattttgacagtggtttgttgggcaagtgcactt
tggtacttaagtgtcactcgcccaacatccaactacagtggctacaagcttagcaaagtg
gtgttggctcagaaaaacattacttttggcaatattagaactcgacctatcaacccccat
tcctttgaatttgttattaacgagcctgagaaatgtgaaaataatgggagcccctttttg
gttattctgataagtacaacccataaggagtttgatgccagacaagccatccgagaaact
tggggtaatgaaagcaacttcaagggaattaaaattgtcacacttttccttctcggcaaa
aatgcagatccagtattaaaccagatggtcgagcaagaaagccaaatatttcacgatatt
gtggtggaagacttcatagattcataccacaatctaaccctcaaaactatgatgggcatg
agatgggtggcaaccttttgctccaaggctaaatatgtcatgaaaacagacagtgatatt
tttgtaaatatggacaatttaatttataaactactgaaaccaaccacaaagccaaggagg
aggtattttactggatatgttatcaatggaggacctataagggatgtccgcagcaaatgg
tatatgccaagagacttgtacccagacagtaattatccgccattttgttcgggaactggg
tacatcttttccgctgacgtggcagaactcatttataaaacatccctccacacaagactt
ttgcatcttgaggatgtgtatgtgggactttgcttgcgaaaacttggaatccacccattt
caaaacagtggctttaatcattggaaaatggcttacagtctgtgccgataccgtagagtg
atcacagtacatcagattggccctgaggaaatgcaccgaatttggaatgacatgcaaagc
aagaagcacctacgatgttaa

DBGET integrated database retrieval system