KEGG   Nanorana parkeri: 108785348
Entry
108785348         CDS       T04897                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108785348 (TGFA)
   04012 ErbB signaling pathway
    108785348 (TGFA)
SSDB
Motif
Pfam: EGF FAM176 TMEM154
Other DBs
NCBI-GeneID: 108785348
NCBI-ProteinID: XP_018409903
LinkDB
Position
Unknown
AA seq 157 aa
MDSARPLKVFCGIWQQAVISRSFKSCKFQDPPVAAAVRSAFRDCTDAHNDFCFHGTCRFL
VQEAEPSCICIQGYVGTRCEHADLLAVVAANQKKQTITALVVVSVVATALLVVACILMHC
CSWRKQCEWCRSVLCRHEKPDGVFKGGASCCKSETVV
NT seq 474 nt   +upstreamnt  +downstreamnt
atggactccgctagacctctgaaggtgttctgtggtatctggcaacaagctgtcattagc
agatcctttaaatcctgtaagtttcaagatcctccagtggcggcggcagtgagatctgct
tttcgagactgcacagatgcccacaacgacttctgcttccacgggacctgcaggttccta
gtgcaagaggccgaaccatcctgcatatgtattcagggctatgtgggtacacgttgtgag
cacgccgacctcctagcggtggtggcagcaaatcagaagaaacagaccatcactgcgcta
gtggtggtgtccgtggtagccacagctctgttggttgttgcctgtatattaatgcactgt
tgcagctggaggaaacagtgtgagtggtgtcgatcagttttatgccgacacgagaaacca
gacggcgtcttcaaaggaggagcatcatgctgcaagtcagagacagtggtctga

DBGET integrated database retrieval system