KEGG   Nanorana parkeri: 108785983Help
Entry
108785983         CDS       T04897                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04210  Apoptosis
npr04625  C-type lectin receptor signaling pathway
npr04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108785983 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108785983 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108785983 (MAP3K14)
   04672 Intestinal immune network for IgA production
    108785983 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108785983 (MAP3K14)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     108785983 (MAP3K14)
Protein kinases [BR:npr01001]
 Serine/threonine kinases: STE group
  Other
   108785983 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 108785983
NCBI-ProteinID: XP_018410686
LinkDB All DBs
Position
Unknown
AA seq 856 aa AA seqDB search
MAIDSHKGQDLVYTNAPVFPPFSLSQSNGVMKNKMCEPGNHFVPVENKNSHWVKLLLNGT
ATEKKESSAMGISIIAQPECENNPQICPTSQEGPMYNQDSKQYSLAESIEHIPNNVVHST
EGKPAQPKRFSKSKRKRRKRSIKEDGQKPAKRGQTTPEQETLAPVPVQDDESQSKPWGDI
LDYCSKQQNSRKNIGYRPENIQPIDGNKNCLHKLISPFQSVYHMGGGKLQQPSSPYFNDR
LSGIISTLGLDGCEDKVNTQWSYAKLIDSCTDSKTHSVEEGVLLALRGSVSVDKPDKLCL
IAKAWEKDDDDSEPVDNEGILFKEGMIPEDYEYREDIHWDKSGDVLGSGAFGDVYLGKDK
TSGFQFAAKKIPVNRFRSQELTCCLSVNSEKIVPVYGAIREGPWITVFMKMLNGGSLGQM
IKRRGYLTEDRALYYLSQVLQGLKHLHTDRVVHGDVKADNVLLSEDRSTAYLCDFGHAAH
LPPGSSGMHLLTANYVPGTETHMAPEIVRGDPCGTKLDVWSACCMLLHMLNGWHPWSRTH
TSPLCLKIATEPPPLQEIPPSSHPLTCDLIMAGLQKDPNNRATTLELKRRVDEALTTIGG
LSSPCESEYREPRNFPSAKKEPETTQAKPKLFPEEPGPVLSQHVKNITQDSSFTTNVRSV
ETRTSCEMEIERLEIDLYRENLTQLFSPEDTQFFSKDSLHPLLSGKESMNTLDTGSSGIH
SWDSQMEAWSLQSDSLFSGGSTTTPSWFNGVKVQLQTFSGETLHIWESGRTKLGDLAVGI
SSQIPIKPFTIVNSDGNPIPWKTDIADCDIELKCSLAQDRGGTWLWRVRKGKIEEGHLEV
ADTGGGRDGSIILIPE
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagactctcacaaaggtcaagacctggtctacaccaatgccccagtgttccca
ccattcagtctgtctcaatctaatggggttatgaaaaataaaatgtgtgaacctggaaac
cactttgttcctgtggagaataagaacagccactgggtcaaattactcctcaatgggact
gccacagagaaaaaagagagttccgccatgggaatctccatcatagcgcaacctgaatgt
gagaataatccacagatatgcccaacttcccaagaaggtcctatgtacaaccaagactca
aaacagtacagtctggctgaaagcatcgagcacatcccaaacaatgtagtgcattctaca
gagggtaaaccagcacagccgaagcgatttagcaaaagtaaaaggaagaggcgtaaaagg
agcattaaggaagacggccagaagccagccaaaagaggccagaccactccagaacaggaa
acactagctccagtgcccgtacaggatgatgaatctcaatcaaagccatggggtgacata
ctggactattgctccaagcagcagaacagcaggaaaaatattggttatcgacctgagaac
atacagccaattgatggcaacaaaaactgtcttcacaagctcatcagcccatttcagtct
gtgtatcacatgggaggtggaaaactgcagcagcctagttctccgtatttcaatgatcgg
ctgtctggaattatcagtaccttgggactagacggctgtgaagacaaagtcaacacacag
tggagctatgctaagctcatagactcctgcacagactcaaaaacccattctgtggaagag
ggggtgttgttagctctgaggggaagtgtgagcgttgacaaaccagacaagctgtgtcta
atcgctaaggcctgggagaaagatgatgatgactcagagcctgtggacaatgaggggatc
ttgttcaaagagggaatgattcctgaagattatgaatatcgagaagatatccattgggac
aaatctggagatgttctaggcagtggtgcttttggggatgtttacttgggaaaggacaag
acatctggatttcaatttgcagccaaaaagatccctgttaacagattcagatctcaggag
ttgacctgttgcctgtctgtgaattctgaaaaaatagtcccagtgtacggggcaatccga
gaaggaccctggatcactgtgtttatgaagatgttgaatggaggctctctgggccagatg
atcaagagacgtggctacctaacagaggacagagctctctattacttgtcacaagttttg
cagggcctcaaacatctccatactgacagagtagtacacggagatgttaaagctgacaac
gttctgctgagtgaagaccgtagcacagcatacctgtgtgactttgggcacgctgctcac
ctccctcctggtagctctggcatgcatctattgacagccaactatgtaccaggtactgag
acgcacatggcccctgaaatagtgcgcggggatccctgtggcacaaaactagatgtgtgg
agtgcatgttgcatgcttctccacatgctaaatggatggcacccatggagccgcacacac
acttcacccctatgtctgaagattgctacagaacctccacctttgcaggagattcctcct
agtagccaccctctaacctgtgaccttataatggccggattacagaaagatccaaataac
agagcaacaactttggagctcaaacgccgagtggatgaggcactaacaacaattggaggc
ctgagctctccatgtgaatcagaatacagggaacccaggaattttccgtcagccaaaaaa
gaacctgagaccacccaggccaaacccaagctgtttcctgaagaacctggacctgtgctt
agccagcatgtcaaaaacataacccaagactcttctttcacaacaaatgtcagaagtgtg
gaaaccagaacctcatgtgaaatggagattgaacgtctagaaatagacctgtacagggag
aaccttacacaactattctctcctgaggatacccagtttttcagcaaggacagcctgcat
ccactgctcagtggcaaggaatctatgaacactttggacactggaagttctgggatccat
tcatgggacagccagatggaagcttggagcttacaaagcgactccctgttcagcggggga
agcacaaccacccctagttggttcaatggggtaaaagtacaattgcaaactttcagtggc
gaaacactgcacatctgggagtctggcagaaccaagttgggagacctggccgtgggcatc
agcagtcagatcccaatcaaaccattcactatagtaaattcagatggaaatcccatcccg
tggaagacagatattgcagactgcgatattgaactgaaatgttccttagctcaagaccgt
ggaggcacctggctctggagggtcaggaaggggaagatagaagagggccatctggaggtg
gcagatactggtggaggaagagatggttcaatcatccttataccagagtga

DBGET integrated database retrieval system