KEGG   Nanorana parkeri: 108786537
Entry
108786537         CDS       T04897                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
npr  Nanorana parkeri
Pathway
npr04141  Protein processing in endoplasmic reticulum
npr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:npr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108786537 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108786537 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:npr03000]
    108786537 (ATF6B)
Transcription factors [BR:npr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108786537 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 FlaC_arch PilJ DUF4407 GAS
Other DBs
NCBI-GeneID: 108786537
NCBI-ProteinID: XP_018411355
LinkDB
Position
Unknown
AA seq 624 aa
MATDLLLNDLDTKFFADNLLTSEDWDTGLYTYGDVSDDCGELFPPGFNSYPLHLYDSQMD
VESCSVSSSLDEIHSVNLSDFLVKAEPASPFSSSSCDSSSSCDGLYTPSLGGVGTSVKVE
LPPSPQCPALETPTTPCGTLQITLLPVSPATGTTGCLPKSNSFLSKKPALQPRPAPGTKP
APTPSSAAHAIILHPVTSPPPAPHAPTLTASSPVLVPQLLTVQNGGHATSPVKSEAKTIV
PAPSTGKSSPTEVDPKLLKRQQRMIKNRESACQSRRKKKEYVQGLEGRLQETQRQLENAR
RENRELRETVQHLMRENTSLRGSSGNRKVVCVMVVLLFLAFNFGPTSFIPSVQEESVKSP
EISSNVRHLLSYKNEDDSSKLPQTKLYTPRPAKPKSTYSNASASLANVKHLMVHDLDQLF
LASDCRHFNRTESLRLADEISLWIRRHQNERKTGKHPPKKQRKIRNPQVRSNVAISDLVP
AHTTRMQSHRIANAPLQLFGPQEHSDHSLMDAIERREDTFYVVSFRRDHLLLPAISHNKT
SRPKMTLVMPALPVNDNVYNNSKGYETMMQIDCEVMDTRVIQIKSSTVPPSLRTPHSPPQ
QQGASRGNLSLYLQDQMTPDDGQN
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggctaccgatctcctgctcaatgacctggacaccaagttctttgcagacaacctgctc
accagcgaggattgggacacaggtctgtacacctatggagatgtgtcggatgactgtggg
gagctgtttccgcccggatttaattcctaccctctgcacttgtacgacagccagatggat
gtggagtcatgttccgtgtcctcgtctctggatgagattcacagcgtgaacttgtcagat
tttttagtaaaggcagaaccagcgtctcccttttcttcatcgtcgtgtgactcttcatcc
tcctgtgatggtctgtacacgccatccttaggaggggtcgggacctctgtgaaagtagag
ctgccaccatctccccagtgtccagccttggagacccctacaaccccctgcggcacatta
cagataactctcctccccgtctccccagccacaggtacgactggatgtcttcctaaatcc
aacagtttcctgtctaagaagccagcattacaacccagacctgcaccagggaccaaacca
gcccccaccccaagctctgcagcgcacgccatcatcctgcacccagtgaccagtccccct
ccagcaccacatgctcctactctcacagcttcttcacctgtgttggtgcctcagctcctg
accgtacaaaatggaggacatgcaacatcacctgttaaatctgaagccaagaccattgtg
cctgccccgagcactggcaagagcagccctactgaggtggaccctaagctcttaaagaga
cagcagcgcatgatcaagaaccgagaatcggcatgccagtctcggaggaagaagaaggaa
tatgtgcagggcttggagggcagactgcaggagacgcagagacagctggagaacgctcgc
cgggagaacagagaactgcgggagacagtgcagcatctgatgagagagaacacctcactg
cgcggctcctccgggaatcggaaagtagtatgtgtgatggttgtacttctgttccttgcc
tttaactttggaccaacaagtttcatacccagtgtacaggaggagtctgtgaaaagccca
gaaatatccagcaacgttcggcacttattgtcttacaaaaatgaagacgactcatcgaag
ctgccgcaaacgaagctctacacgccccgtcctgctaaaccgaagagcacttacagtaat
gctagtgcgtcactggctaacgtgaagcacctgatggtccatgacttggatcagcttttc
ctggcatcggactgcagacactttaatcgcactgagtccctcagattagctgatgagatc
agcttgtggattcgtcgacatcaaaatgaaaggaagacaggaaagcatcctccaaaaaag
cagaggaaaataaggaatcctcaggtacggagcaacgtggccatatcagacctggtccca
gctcacacgaccagaatgcagtcacataggatagcgaatgctcctctgcagctgttcggt
cctcaggagcacagcgatcattccctgatggacgccatcgagagacgggaagataccttc
tatgtggtctcattccggagggatcatcttctcttgccagctataagtcacaacaagaca
tctcggcctaaaatgactctggtgatgccagccttgcctgtgaatgacaacgtgtacaac
aactccaaaggctatgagaccatgatgcagatagactgcgaggttatggacaccagagtc
atccaaatcaagtcctccacggtccctccttcactgcgcacgcctcacagtcctcctcaa
cagcagggggcgtcacgggggaacctctccctatatctacaggaccaaatgacgccggat
gatggtcagaactga

DBGET integrated database retrieval system