KEGG   Nanorana parkeri: 108787523
Entry
108787523         CDS       T04897                                 

Gene name
SETD7
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD7
  KO
K11431  [histone H3]-lysine4 N-methyltransferase [EC:2.1.1.364]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
npr04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108787523 (SETD7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108787523 (SETD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108787523 (SETD7)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.364  [histone H3]-lysine4 N-methyltransferase
     108787523 (SETD7)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108787523 (SETD7)
SSDB
Motif
Pfam: MORN SET DsbC_N
Other DBs
NCBI-GeneID: 108787523
NCBI-ProteinID: XP_018412600
LinkDB
Position
Unknown
AA seq 365 aa
MDSDDENVEETVEGQLDDDGLPHGLCMVSYSSTDRFEGHFVHGEKNGRGKFFFFDGSTLE
GFYVDDALQGQGVYTYEDGGVLHGTYVDGELNGPAQEFDTDGRLIFKGQYKDNIRHGICW
IYYPDGGGLVGEVNEDGEMTGNKIAYVYPDGRTALHGKFIDGEMLEGKLAFLTSVKEGWP
HFEIIPDSKVYSFDKSTSXCISIDTILPPYQIERMYIADSLISNAGEGLYAKIAAGPNTV
MSFYNGVRITHQEVDSRDWSLNGNTISLDEETVIDVPEPFKATAKYYASQGHKANHSFNP
NCMYDLFVHPRFGPIKCIRTISAVEKDEELTVAYGYDHNATGNNGPEAPEWYQQQLKAFH
MCQQK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggacagcgatgatgaaaacgtggaggagacggtggaaggacaattagatgacgatggt
ctgcctcatggcctgtgcatggtcagttacagctccacagatcgctttgaggggcatttt
gtacatggcgaaaaaaatggacgcggcaaattcttcttctttgatggaagtactttggaa
ggtttttatgttgacgatgcgttgcaaggacaaggagtatatacatatgaggatggaggt
gtcctacatggcacatacgtggacggggagctgaatggaccagcacaggagtttgatacg
gatggaaggttgatattcaaaggtcaatataaagacaacatccgacatggcatctgctgg
atttactacccagatggaggcggccttgtgggagaggtgaatgaagatggggaaatgaca
gggaataagatagcctatgtctatcctgatggaagaacagcactgcatgggaaattcatt
gatggagaaatgctggaaggaaagctggccttcctcacgtctgttaaagaaggatggcca
cactttgaaattatccctgacagtaaagtttattcttttgataaatcaacttcatagtgt
atttctatagacacaattctcccgccataccagattgaaagaatgtatatagcagactcg
cttatttccaatgctggagaaggtctctatgctaaaatagctgctggccccaatactgtg
atgtcattttacaatggtgttcggattacacatcaagaggtcgatagcagagattggtct
ttgaacggcaatacaatttctttagatgaggaaactgtaattgatgtaccagagcccttc
aaagcgactgctaaatattatgcctcccaagggcacaaagccaaccactccttcaatccc
aactgtatgtatgacctgtttgtccacccaaggtttggacctatcaagtgtatccgaacc
atttcagctgtggagaaggatgaagaacttactgtggcctatggctacgaccacaacgct
acagggaataatggtcctgaggcaccggaatggtaccagcagcagttgaaggcatttcat
atgtgtcagcagaagtga

DBGET integrated database retrieval system