KEGG   Nanorana parkeri: 108787706Help
Entry
108787706         CDS       T04897                                 

Definition
(RefSeq) cadherin-1-like
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
npr  Nanorana parkeri
Pathway
npr04371  Apelin signaling pathway
npr04514  Cell adhesion molecules (CAMs)
npr04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108787706
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    108787706
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108787706
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108787706
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:npr04515]
    108787706
   04090 CD molecules [BR:npr04090]
    108787706
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    108787706
Cell adhesion molecules [BR:npr04515]
 Cadherins
  Major cadherins
   108787706
CD molecules [BR:npr04090]
 Proteins
  108787706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Big_9
Motif
Other DBs
NCBI-GeneID: 108787706
NCBI-ProteinID: XP_018412821
LinkDB All DBs
Position
Unknown
AA seq 834 aa AA seqDB search
MAVSDHPLSQRPPHLRQELTLRFGMVFVTCGLKSNIRYESEDSHFEVEADGSVVVKDHLK
LHGHKEFSVLALEGNNVLSETTVTLRKQHPHHKQAEHSHPSQSVRELRRQKRDWVIPPIS
CSENERGPFPKRLIQVKSSRATETTVYYSITGQGADSQPIGTFAMERNTGWLNVTRQLDR
ETIPTYKLLVYAVASNGQKVENPIDILIKVTDQNDNRPIFTQQVFDGTVVEGSKPGTPVM
NVSATDLDDTEDTNNGIIAYSIVDQDPLLPNQMFTIDQVSGLISVLTSGLDRELYPVYTL
TLKAIDQEGAGYEATGKAVITVTDANDNAPVFDPITYLEKVPENKEGYEVALLTVTDDDT
PNTDAWTAVFKIVKGNEGNLFGITTTPDNMGQLKTVKALDFEAKRQHILLIVATNKANFS
VPVITSTATVTVDVEDVNEPPMFVPPVKDVNIPEDLPSGQEVASYTAQDPDKAQNQKITY
YIGNDPAGWLTVNPENGIITGNGQLDRESIFVKNNTYRAIILAVDNGSPATTGTGTLQII
LGDVNDNGPYLEYQEVIYCQKSPDPLSINIIDRDLPPFQDPYKAQLTREARENWTASVVN
TKFEIKANREMAEDVYQVPVTLADSQDKTNITVLKIQVCQCTAENNNCDTPKALAGGLGI
PVILGILGGILALLILLLLLLLFVRKRKVVKEPLLPPEDETRDNVYFYDEEGGGEEDQDF
DLGQLHRGLDARPDVIRNDVAPTFMPAPQYRPRPANPDEIGNFIDENLNAADNDPTAPPY
DSLLVFDYEGSGSDAASLSSLNSSNSDADQDYSGLNDWGPRFRKLADMYGGDED
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggcggtatcagatcacccgctttcccagcgtcctccacacctgcgacaagagctaacg
ctgagatttgggatggtcttcgttacctgtgggctgaaatcgaacatacgctatgaatcg
gaagactctcattttgaagttgaagctgatggctctgtcgtagtaaaagatcatctaaaa
cttcatggacacaaagagttcagtgttctggcattggagggtaacaatgttttatctgaa
accaccgtgacactgagaaaacaacatcctcatcacaaacaggctgaacattcacatccc
tcccagtctgtacgtgagcttaggagacaaaagagagactgggtcattccaccgatttca
tgctctgaaaatgaaagaggcccatttcccaaaaggctcattcaggtcaaatccagtagg
gcaaccgagactaccgtgtactacagcatcacaggccaaggggccgactctcaacccata
gggactttcgccatggagaggaatactggctggcttaacgtgactcggcaactggacaga
gagactatacccacatacaagctcttggtctatgccgtagcctcaaatgggcaaaaagtg
gagaacccgattgacattcttatcaaagtgacagatcagaatgacaatcgtccaattttc
acacaacaagtgtttgatggcaccgtagtcgaggggtccaaaccagggactcctgtcatg
aatgtctcagcaacagatttagatgacaccgaagacaccaataatggcattatcgcgtac
tccatcgtagatcaagatcctctattgccaaaccagatgttcactatcgatcaagtcagc
ggactgatcagcgttttgacttctggattagatcgcgagctgtatcccgtgtatactttg
accctcaaagcaatcgatcaggaaggtgcaggatacgaagccaccggcaaagctgtaatc
actgtaacagatgccaatgacaatgctccggtttttgaccccattacgtatttagaaaag
gtccctgagaataaagaggggtacgaggttgcactgctgacagtcacagatgatgacacc
cccaacaccgatgcctggacggccgtgtttaagattgttaaaggcaatgaaggaaatctt
ttcggcataactacaactccagataacatgggtcaactaaaaaccgttaaggcactggac
tttgaggcgaagagacaacacattctgttgatagtggccaccaacaaagccaacttttct
gtaccagtaataacctctaccgccacagtcacggtggatgtggaggatgtgaatgagcct
ccgatgtttgtgccgccagtgaaggatgtcaatatcccagaggatcttccaagtggccaa
gaggtggcttcctacacagctcaggacccagacaaggcacagaatcaaaagataacttat
tacatcggcaacgacccagctgggtggctcacagtaaatccagagaatggaattatcaca
ggaaatggacaattagatcgagagtccatatttgtcaagaacaacacttacagggccatc
atcttagctgtggacaatggttcacccgctacaaccgggacaggcacccttcagatcatt
cttggagatgtgaatgacaatgggccgtatttggaataccaagaagttatatattgccag
aagagtccagaccccctatctatcaatatcattgacagagatctgcccccgtttcaagac
ccatacaaggcacaactgacacgcgaagcgcgtgaaaactggacagccagtgtggtaaat
actaaatttgagattaaggcgaacagggagatggctgaagatgtctatcaggtgcccgtc
acccttgccgacagccaggataagacgaacataactgtgttgaagatacaagtgtgccag
tgcacagccgaaaataacaactgtgacactccgaaagcattggctggaggcctgggcatc
cctgtcatccttggcatcctggggggtatcctggcacttctgatactcctattgctgctt
ctgctgtttgtgaggaagaggaaggtggtgaaggagccattactgcctcctgaagatgaa
acgcgggataacgtctacttctatgatgaagaaggtggcggagaggaagatcaggatttt
gaccttggccagcttcaccgtggtctcgatgcccgccctgacgtcattcgtaatgatgtt
gcaccaacatttatgcccgctcctcagtaccggccaagaccagccaatcccgatgagatc
ggaaactttatcgatgagaatctgaacgcggctgacaatgaccccaccgccccaccgtac
gactcactactggtgttcgactacgaaggcagcgggtcggacgccgcctctctcagctcc
ttgaactcctccaactctgacgccgatcaggattacagcggtctgaacgactgggggcca
cgtttcagaaagttggcagacatgtacggaggagatgaggattaa

DBGET integrated database retrieval system