KEGG   Nanorana parkeri: 108788266Help
Entry
108788266         CDS       T04897                                 

Gene name
SUV39H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:npr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108788266 (SUV39H1)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108788266 (SUV39H1)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108788266 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108788266 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 108788266
NCBI-ProteinID: XP_018413509
LinkDB All DBs
Position
Unknown
AA seq 424 aa AA seqDB search
MAENLNAVRGCSVACLSTESHVQELCRIEHVCCATLGVNRKNICNFEVEYLCDYKRVQEE
ELYLVKWKGYPDSECSWEPRRHLRCFNLLRQFHRDLERELLRRAKAAGTSTSKKVVGRCP
RRLDSSLSHYVVLKAKQRQRLRLWEQKLNSKRAHPGLITVENEVDLEGPPRDFVYINEYK
VGEGVTITKSAVGCKCRDCFTDERGCCPGGFQHKFAYNADGQVKVKPGFPIYECNSLCRC
GPSCPNRVVQKGIQYKFCIFRTSDGRGWGVRTLEKIRKNSFVMEYVGEIITSDEAERRGQ
IYDRQGATYLFDLDYIEDVYTVDAAHYGNISHFVNHSCKPNLQVYNVFIDNQDERLPRIA
FFATRTIRTGEELTFDYRMQVDPVDVESTKMDTNFGLAGLTGSPKKRTRVECKCGVNSCR
KYLF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaatttaaacgcagttcgtggttgttcagttgcatgtctgtccacagagtct
catgttcaggagttgtgtcgaattgagcatgtttgttgtgctactcttggggtgaaccgg
aaaaatatctgcaattttgaagtggaatatttgtgtgactataagagggtgcaggaggag
gaactgtaccttgtgaagtggaaaggctacccggattctgagtgttcatgggaaccacgt
cgccatctcagatgcttcaacctccttcggcagtttcaccgggatctggaacgagagctg
ctacgaagggcaaaggctgccggaacatcaaccagtaaaaaagtagttgggcgctgcccc
cgcagactagattccagcctctcacactatgtggtgcttaaagcgaagcaaaggcaacgg
ctccgtttgtgggagcagaagttgaattccaaacgggcccatccaggccttataacagta
gaaaatgaagtggatctagagggtccacccagagactttgtgtacattaatgagtacaag
gttggggaaggagtgaccattaccaagtctgctgtagggtgcaaatgtcgggactgtttc
acagatgagagaggatgctgtcctggaggtttccagcacaaatttgcttataatgcagat
ggacaagtgaaagtgaaacctggctttccaatttatgaatgcaactccctctgccgatgt
ggcccgtcttgcccaaatagagtggtgcagaaaggaatccagtataaattctgtattttc
aggacctctgatggaaggggatggggtgtgaggacactggagaagatccgcaaaaacagc
tttgtaatggaatatgtgggagagataatcacttctgatgaggcggagcgtagaggacaa
atctatgaccgacagggggcaacttatctgtttgatctggattacattgaagatgtttac
accgtagatgctgctcactatggaaatatatcgcactttgtcaaccacagttgcaagcct
aacctccaagtatacaacgtgtttattgataatcaggatgagaggttgcctcgcattgcg
ttttttgctacgcgtactatccgtactggagaagagctcacgtttgactacagaatgcag
gtcgacccagttgatgttgaaagcacgaaaatggacaccaactttggtttggccggccta
actggatctccaaaaaaacgcacacgggtggaatgcaaatgtggggtaaacagctgtcgt
aaatacctcttttaa

DBGET integrated database retrieval system