KEGG   Nanorana parkeri: 108788543Help
Entry
108788543         CDS       T04897                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
npr  Nanorana parkeri
Pathway
npr00010  Glycolysis / Gluconeogenesis
npr00053  Ascorbate and aldarate metabolism
npr00071  Fatty acid degradation
npr00280  Valine, leucine and isoleucine degradation
npr00310  Lysine degradation
npr00330  Arginine and proline metabolism
npr00340  Histidine metabolism
npr00380  Tryptophan metabolism
npr00410  beta-Alanine metabolism
npr00561  Glycerolipid metabolism
npr00620  Pyruvate metabolism
npr01100  Metabolic pathways
Module
npr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108788543 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    108788543 (ALDH2)
   00620 Pyruvate metabolism
    108788543 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108788543 (ALDH2)
   00561 Glycerolipid metabolism
    108788543 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108788543 (ALDH2)
   00310 Lysine degradation
    108788543 (ALDH2)
   00330 Arginine and proline metabolism
    108788543 (ALDH2)
   00340 Histidine metabolism
    108788543 (ALDH2)
   00380 Tryptophan metabolism
    108788543 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108788543 (ALDH2)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108788543 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108788543
NCBI-ProteinID: XP_018413829
LinkDB All DBs
Position
Unknown
AA seq 522 aa AA seqDB search
MLRAAIGNLCSRVSSVPLVGQISRFSAAAIPAPNPKPDVHFNQLFINNEWHDAASKKTFP
TINPSTGEVICHLAEGDKADVDKAVKAARNAFTLGSPWRRMDASQRGVLLNRLADLIERD
RAILASLETLDNGKPYAISYAVDLDLVLKCLRYYAGWADKWHGKTIPIDGDYFTYTRHEP
VGVCGQIIPWNFPLLMLAWKFGPALATGNVIVMKVAEQTPLTALHVASLVKEAGFPPGVV
NIITGMGPTAGAAISSHMDVDKVAFTGSTEVGRLIQQAAGKSNLKKVSLELGGKSPNIIF
SDADLDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYKEFVERSVHRAKNRVVGNPFDFK
TEQGPQVDEEQFKKILGYIKSGKQEGAKLLCGGNPAADRGYFIQPTVFGDVTDNMTIARE
EIFGPVMQILKFKTIEDVIERGNSSEYGLAAAVFTKDIDKANYVSHSLRAGTVWVNCYDV
FGAQAPFGGYKASGVGRELGEYGLEAYTEVKNVTIKIPQKNS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctccgggctgccataggaaacctctgctccagggtctcctctgttcctctggtggga
cagatcagccggttctctgctgctgccattcctgcacccaatcctaaaccagacgtgcac
tttaaccagcttttcataaacaatgaatggcatgatgcagccagcaagaagaccttcccc
accatcaacccatccaccggagaggtcatctgccatcttgcagagggcgataaagcagat
gttgacaaggccgtaaaagcagcccggaatgcgttcacgttgggatcaccatggagaaga
atggatgcctctcaaaggggagttttgctaaacagacttgctgatcttattgagcgggac
agggctattctggctagtttggaaaccctggataatggaaagccctatgccatctcctat
gcagtggacctggatcttgtactcaaatgtctgagatattatgctggatgggctgataaa
tggcacggcaaaaccattcctattgatggagattatttcacctataccaggcatgagcct
gttggggtctgtggacagatcataccgtggaatttcccattgcttatgcttgcatggaag
tttggtcctgccctggcaaccggaaatgtgattgtcatgaaggtggctgaacagacgcct
cttactgctcttcatgtcgccagcctagtgaaagaggctggatttccacctggggttgtt
aacatcattacaggaatgggacccacagcaggtgctgccatctcttctcacatggatgta
gataaagttgcctttactggctctacagaggtgggtcgtctgattcagcaagcagctggt
aagagtaacttgaaaaaggtcagcctagagcttggcggaaagagccccaacatcatattt
tctgacgcagacttggactgggctgtggagcaagcccactttgctcttttcttcaatcaa
ggacagtgctgctgtgcaggctctcgtacctatgttcaggaggatatttacaaggagttt
gtggagaggagtgtccaccgggccaaaaacagggttgtcggaaacccctttgacttcaaa
acggaacaaggacctcaggtggatgaggaacaatttaagaagattctgggctacataaaa
tctggaaaacaggaaggtgcaaagttgttgtgcggtgggaatcctgctgctgaccgtgga
tactttatacagcccacagtgtttggagatgtgactgacaacatgaccattgccagagaa
gagatttttggaccagtgatgcagatcttaaaattcaagacaattgaggatgttattgag
cgaggcaacagctccgagtatggtctggcagcagctgtgttcacaaaagacattgacaaa
gcaaactatgtatctcattctttgcgggctggaacagtatgggtcaactgctatgatgtc
tttggagcccaagcaccttttggagggtacaaagcttctggagttgggagagagctggga
gaatatggattggaggcatacacagaagtgaagaatgtgaccatcaaaatcccacaaaag
aattcgtaa

DBGET integrated database retrieval system