KEGG   Nanorana parkeri: 108788619Help
Entry
108788619         CDS       T04897                                 

Gene name
OGDHL
Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial isoform X1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
npr  Nanorana parkeri
Pathway
npr00020  Citrate cycle (TCA cycle)
npr00310  Lysine degradation
npr00380  Tryptophan metabolism
npr01100  Metabolic pathways
npr01200  Carbon metabolism
Module
npr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
npr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108788619 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    108788619 (OGDHL)
   00380 Tryptophan metabolism
    108788619 (OGDHL)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     108788619 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 108788619
NCBI-ProteinID: XP_018413925
LinkDB All DBs
Position
Unknown
AA seq 1016 aa AA seqDB search
MSHLRSLAVKLKPCGFGLLVRSTVNAKTLPPRCCVYSSGAKEPFLSGTNSSYVEEMYYAW
LENPKSVHQSWDAFFRKADPGAIGEANPVQNVDLQNRASIIRSHGLAMATAKAEKLVEDH
LAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLGFYGLHEGDLDKVFR
LPTTTYIGGNETSLSLREIIRRLENSYCQHIGLEFMFINDVEQSQWIRQRFETPGIMRFT
NEEKRTLLARLVRSTRFEDFLARKWSSEKRFGLEGCEVMIPALKMLIDASSEMGLEYVIL
GMPHRGRLNVLANVIRKDLEQIFCQFDPKLEASDEGSGDVKYHLGMYHERINRATNKKLT
LSLVANPSHLEAVDPVAQGKTKAEQFYRGDNEGKKVMSILVHGDAAFAGQGVVYETFHLS
DLPSYTTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVC
SVAAEWRNTFHKDVVIDLVCYRRSGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLISE
GIVSLQAFEEEIAKYDKICEEAYTQSKDKKILNIKHWLDSPWPGFFTLEGEPKSMTCPPT
GITEDMLSHIGNVASSVPVENFKIHGGLSRILKSRLEMTQNRLVDWALAEYMAFGSLLKE
GIHVRLSGQDVERGTFSHRHHVLHDQDVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLG
FELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMG
PEHSSARPERFLQMSNDDCDAYPVFTPDYEVTQLYDCNWIVVNCSTPANYFHVLRRQILL
PFRKPLIIFTPKSLLRHPEAKSSFEEMKTGTVFQRVIPESGAACHNPQDVRRVIFCTGKV
YYELVKEKHQKQLESQVAIIRLEQISPFPFDLVKEEVEKYCNAEMVWCQEEHKNMGYYDY
IKPRFLTILNHARPIWYAGREPAAATATGNKNTHLVELRRFLETAFNLRSFEGKTF
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgagccacctcaggtctcttgcggttaaactgaagccatgtggctttggtttgctggtg
aggtcaactgttaacgccaagacattgccaccaagatgttgtgtttattcttctggagcc
aaagagccgtttttaagtggaaccaactcaagttatgtagaagaaatgtattacgcatgg
ttggagaacccgaagagtgttcaccagtcatgggatgcctttttccgcaaagcagatcct
ggagctattggtgaagccaatcctgtccaaaatgtcgatttacagaacagagcttcgatt
attcgcagtcatggccttgctatggcaacagccaaagcagagaagctagtggaggaccat
ttggcagtgcagtccttaattagagcctaccagatccgtggacatcatgtggctcagctg
gaccctctaggaattctggatgccgatttggactcttttgttccatcggatctcatcacc
acaattgataaacttggtttttatggactgcatgagggagatttagataaagtattcaga
ctgccgacaactacctacattgggggtaatgaaacttccctgtctctgcgagagatcatt
aggagattggagaattcatattgtcaacatattgggctagaattcatgttcatcaatgat
gtggagcagtcccagtggattagacaaagatttgagactcctggtatcatgaggttcacc
aatgaagaaaaaagaacattgttggcaagattagtgcgctctacaaggtttgaggatttt
ctagctcgcaagtggtcatcagagaagagatttggtctggaaggctgtgaagtcatgatc
cctgctttaaaaatgctaattgatgcgtccagtgagatggggctggagtatgtcatcctg
ggaatgcctcatagaggaagattaaatgtcttggcaaatgtgatccgtaaagatttggag
cagattttttgccagtttgaccctaagttggaggcctcggatgagggttctggagatgta
aagtaccacttggggatgtaccatgaacgcattaatcgggccaccaacaaaaagctaacc
ctgtctttggttgcaaacccttcacatctggaagcagtagatcctgtagctcaggggaag
accaaagcagagcaattttatagaggagacaacgaaggaaaaaaggtgatgtccatttta
gttcatggtgatgcagcctttgctggacaaggtgttgtttatgagacctttcatctcagt
gatcttccatcttacactacaaatggaaccattcacgttgttgtgaacaaccagattggt
ttcaccacagaccctcgcatggctcgctcttccccatatcccacggatgtggctcgcgtg
gttaatgcccccatatttcatgtgaatgcagatgatccagaagcagtaatgtatgtgtgc
agtgtagctgcagaatggagaaacacctttcataaggatgttgttatagacctggtctgc
taccgtcgcagtgggcataatgaaatggatgaacccatgttcacccagccattgatgtat
aaacagatccataaacaggtcccggtgttgaagaagtatgcagacaagctgatctctgag
ggcattgtttccctgcaagcgtttgaggaagagattgccaagtatgacaagatttgcgag
gaggcgtatacacagtctaaggacaagaaaatccttaacataaagcattggttggactct
ccatggcctggattttttacattagagggagaaccaaaaagcatgacctgccccccaacg
ggtatcaccgaggatatgctttctcatattggcaatgttgccagctctgtcccagtggag
aattttaaaatccatggaggtctctccaggatcttgaaaagtagattggaaatgacacag
aatcggctggtagactgggcattggctgagtacatggcatttgggtcattgttgaaagaa
gggatacatgtcaggctgagcggccaggatgttgaaaggggaacatttagccatcgccat
cacgttttgcatgatcaggatgtagaccgccggacatgtgtcccaatgaatcacctgtgg
ccagaccaagctccatacactgtgtgtaacagctccctgtctgaatatggagtcctgggc
tttgagcttggttttgccatggcgagtcctaatgccttggttttgtgggaagctcagttt
ggcgattttcataatacagcacaatgcataattgaccagtttatcagctcaggacaagca
aagtgggtacggcacaatggaatcgttttgctcctaccgcatggtatggaaggaatggga
cctgagcattcttcagccagacctgaaaggttcctgcagatgagcaatgatgactgcgat
gcttatcctgtatttactccagactatgaagttacacaactgtatgactgcaactggatc
gtagtcaactgttcaacgcctgctaattactttcatgtcctcaggcggcaaattttattg
cccttccgcaaaccgctcattatttttacccccaaatcattgttgaggcatcctgaagcc
aaatctagctttgaagaaatgaaaacaggtacagtcttccagcgtgtgattcctgagagt
ggagcagcttgtcacaatcctcaggatgtgagacgggtcattttctgcactgggaaggtt
tattatgagcttgtcaaggagaaacatcaaaaacagctagaaagccaagtagcaatcata
cggctggagcagatatcaccattcccatttgacttggttaaagaagaggttgagaaatat
tgcaatgcagaaatggtatggtgccaggaagaacataaaaatatgggctactatgactac
atcaagccacgtttcctcaccattctgaaccatgcaagaccaatttggtatgctggtcgg
gagcccgcagcagctacagctactggcaacaaaaacactcaccttgtggaactgaggagg
tttttggagactgctttcaatctgcgctcctttgaaggaaagactttttga

DBGET integrated database retrieval system