KEGG   Nanorana parkeri: 108788704
Entry
108788704         CDS       T04897                                 

Gene name
PRDM12
Definition
(RefSeq) PR domain zinc finger protein 12
  KO
K24255  PR domain zinc finger protein 12 [EC:2.1.1.-]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108788704 (PRDM12)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     108788704 (PRDM12)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108788704 (PRDM12)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_2 SET zf-C2H2_6 zf-Di19 CBM_3 zf-BED HypA Elf1 zf-H2C2_5
Other DBs
NCBI-GeneID: 108788704
NCBI-ProteinID: XP_018414041
LinkDB
Position
Unknown
AA seq 355 aa
MMGSVLPAEALVLKGGLNKPTMSLTEMITSDILHSFLYGRWRNVLGEQLFEEKNNHSSPK
TAFTAEVLAQSFSGEVQKLSSLVLPSEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGR
VISPEHVDLCKNNNLMWEVFNEDSTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQI
GNSIFYKAIETIPPDQELLVWYSNTQSTFLGIPGVPGIEEEQKKTKHDEFGGIDSSGPVL
SGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPY
KCQVCQSAYSQLAGLRAHQKSARHRPPNGSIQAHSPNLPVPHPASLAHHIPTMVL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgatgggctcggtgctccctgcggaagccctggtgctgaagggtgggttgaacaagccc
accatgtccctgactgagatgatcacctctgatatcctacacagcttcctctatgggcgc
tggaggaacgtcctgggcgagcaactttttgaagagaagaacaaccacagcagtccaaaa
actgcattcacagctgaggtcctggcacagtccttctcgggagaggtgcaaaagctttcc
agtctcgtcctgccatcagaagtaatcattgcccagagctctatccccggtgaggggctt
ggcatcttctcaaagacctggattaaggccgggactgagatgggaccgttcactggcaga
gttatctctccggagcatgtggacctgtgcaagaacaacaatctgatgtgggaggtgttc
aatgaagatagcacagtgcgttatttcattgatgccagccaagaagaccaccgcagctgg
atgacttatatcaagtgtgcccgcaatgagcaggagcagaacctggaggtggtgcaaatt
gggaatagcatcttctacaaggccatagagacaatccctccagaccaagaacttttggta
tggtatagcaacacacaaagcaccttccttggcatccctggggtccctggaatagaagag
gaacaaaagaaaactaaacatgatgaatttggtggtattgattcttctggaccagtcctg
agcggtcgaatgcgctgcgtcatctgtcaccgcggcttcaactcccgcagtaatttacgc
tcacacatgagaattcacactctggacaagcccttcgtatgccgcttttgcaaccgccgc
ttcagccaatcttccaccttgcgtaaccacgtccgactgcatactggagagcgcccttac
aaatgccaagtatgccaaagtgcctactcacagctagccggcctgagagcccatcagaag
agcgcacggcaccgtccaccaaacggctccattcaagctcattctccaaacctgcccgtg
ccacacccggcctctcttgctcaccacatccccaccatggtcttgtga

DBGET integrated database retrieval system