KEGG   Nanorana parkeri: 108788861Help
Entry
108788861         CDS       T04897                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
npr  Nanorana parkeri
Pathway
npr00562  Inositol phosphate metabolism
npr01100  Metabolic pathways
npr04068  FoxO signaling pathway
npr04070  Phosphatidylinositol signaling system
npr04115  p53 signaling pathway
npr04140  Autophagy - animal
npr04150  mTOR signaling pathway
npr04218  Cellular senescence
npr04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108788861 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108788861 (PTEN)
   04070 Phosphatidylinositol signaling system
    108788861 (PTEN)
   04150 mTOR signaling pathway
    108788861 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108788861 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    108788861 (PTEN)
   04218 Cellular senescence
    108788861 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108788861 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:npr01009]
    108788861 (PTEN)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108788861 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     108788861 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     108788861 (PTEN)
Protein phosphatases and associated proteins [BR:npr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    108788861 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 108788861
NCBI-ProteinID: XP_018414253
LinkDB All DBs
Position
Unknown
AA seq 456 aa AA seqDB search
MVRVQGFLSVPPGQPRCLFPHSPEIAVDPSARTEGEYPLERVWDKRRKGCLLIHSVSNQE
FVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKI
YNLCAERHYDTNKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENDNVAAIHCKAGK
GRTGVMICAYLLHRGKFIKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDY
RPVALLFHKMMFETIPMFSGGTCNPQFVIYQLKVKIFTSSTGPTRREEKYMYFDFPQALP
VCGDIKVEFFHKQNKMMKKEKMFHFWINTFFIPGPEEYLDKVENGTLLGEQELDGIKSTE
RSDNDKEYLALALTKNDLDKANKDKANRYFSPNFKVKLFFTKTVEESSNSEASSSTSVTP
DVSDNEPDHYRYSDTTDSDPENEPFDEDQITQITKV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtgttcagggattcctcagcgttcccccagggcagccaaggtgtttgtttccc
cactctcctgagattgccgtggatccgtccgcgcggaccgagggagagtatcccttggag
agggtgtgggacaagaggcgcaaggggtgcctcctcatccattcggtctccaaccaggag
ttcgtcagcaggaacaaaaggcgatatcaggaggatggattcgacttggacttgacctat
atttatccaaacataattgccatgggatttccagcagaaagacttgaaggtgtatacaga
aacaatatagatgatgttgtaaggtttttggattccaagcataaaaaccattacaagatc
tacaatctatgtgctgaaagacattatgacaccaacaaatttagctgtagagttgcacag
tatccttttgaagaccacaatcctccacagttagagctaatcaaaccattttgtgaagat
cttgaccaatggctaagtgaaaatgacaatgtagcagcaatccactgtaaagcaggcaaa
ggtcgtacaggagtcatgatctgtgcttatttgctacatcgaggcaagtttataaaggca
caagaggcattagatttttatggagaggttcggaccagggacaaaaagggtgtgacaatt
cccagccaaaggcgctacgtatattactacagctacttgttaaaaaatcatttggattac
agaccagtggcacttctctttcacaagatgatgtttgaaacaattccaatgttcagcggt
ggaacatgcaatccccagtttgttatctatcagctgaaggttaagatatttacatcctct
acaggacccacaagacgtgaggagaagtacatgtattttgacttcccgcaggctcttcct
gtttgtggagatataaaggttgagtttttccacaaacagaacaagatgatgaaaaaggaa
aaaatgtttcatttttggataaatacgttcttcatacctggtcccgaagagtatttagac
aaagtagagaatggaacattacttggagagcaggaacttgatggtatcaaaagcacggaa
cgttcagataatgacaaggaatatctcgctctcgcattaacaaagaacgacctagataaa
gctaacaaggacaaggccaacagatacttctcaccaaacttcaaagtaaagctatttttc
actaaaaccgtagaagaatcttcaaattcagaagcaagcagctcaacttcagtaacaccg
gatgttagtgacaatgaacctgatcattatcgatactctgacaccactgactctgaccca
gagaatgaaccttttgatgaagatcagattacacagattacaaaagtctga

DBGET integrated database retrieval system