KEGG   Nanorana parkeri: 108789331Help
Entry
108789331         CDS       T04897                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
Organism
npr  Nanorana parkeri
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 108789331
NCBI-ProteinID: XP_018414810
LinkDB All DBs
Position
Unknown
AA seq 743 aa AA seqDB search
MDESNKKAHHTDMYNSSELILRRGQSCRLTLEFNKPLRDWQSIVFIAHTGPQNSGYPNTD
VQFPLSSSWSSGMWSAVLESSPGNSLKIIMSSPANAAIGRYDLSVQISVMGQTVTYSLGK
FILLFNPWCLDDDVYLANEEERQEYVLNDHGVIFMGNEKHVTGMGWNYGQFENNILNICL
DIMDRSLNCQKDPALDCSQRHNPIYVGRIVSAMINSNDDYGVLEGKWEKDFSDGVDPNSW
NGSVEILWQWKNGNFKPVKYGQCWVFAAVMCTALRSLGIPTRVITNFNSAHNTDGNMIID
MHYDTEGKFLELSDDSIWNFHVWNESWFLRRDLGIYYSGWQVLDSTPQEESQGIYQCGPT
SVIAVKEGDTHLGFDTPFVFAEVNADRETWVVQKDGTKEKAHNDTKYIGQSISTKAVGSD
ARVDITNNYKYPEGSPQERQVFEKASRNMPNYVPPTENVSPGPDNMMNRNRNDSPMRSST
PTPNADPNGRPSSPALFSGYPSQPSNSANAYWPASPSPNPPQPSYSTSAGTDIAGKFKLL
SPLVVGDDINLLLILKNLTPYHRPVRVNLSASAILYTGRRMNDLFTDQKSLIISPNQDAH
ISLQIPYSHYSRGLNEGNMIQVVALCELPFGSKIVITKDLVLENPPITIKPLSNPMLHKT
MTLEIRFTNPLQMAITDCTLVVEGSGLVDRQLLAVVPYLKPKEKIKFKVELTPYRPGTRQ
LIANFKCKYFSIKGYQSLNVESW
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggatgaatccaataaaaaggcccatcacacggatatgtataacagctctgagctgata
ctacgcagaggacaatcttgcagattaactctggaattcaacaaaccacttcgtgactgg
cagagtatagtgttcattgcacacacaggtccacagaactcaggatatccgaacacagat
gtgcagtttcctttgtccagttcatggagcagtggcatgtggagtgcagttctagagtcc
agccctggcaattccctgaagataataatgtccagccccgccaatgcagccatagggaga
tatgacctcagtgttcagatctctgtgatgggtcaaacagtcacatattcacttggcaaa
ttcatactgctttttaacccctggtgtctagatgatgatgtgtacttggccaacgaagaa
gagaggcaagaatatgtcctaaatgaccatggtgtcattttcatgggaaatgagaagcat
gtaacaggcatgggatggaactacggtcagtttgaaaataatattctgaatatctgcctg
gacattatggatagaagtctgaactgtcagaaagacccagctctagattgctcccagagg
cacaatcccatctatgtgggaagaatcgtcagtgcaatgatcaacagcaatgatgactat
ggtgtacttgaggggaaatgggaaaaagacttttcagatggggtagacccaaacagctgg
aatggaagtgtggaaatcctttggcaatggaaaaatggtaacttcaagccagtgaagtat
ggccagtgctgggtctttgcagcagtgatgtgtacagccctccggagtctgggcattccg
accagagtcatcacgaatttcaactctgcccataacacggatgggaacatgattatagac
atgcactatgacacagaaggaaagttcctggagctctctgatgacagcatttggaacttt
catgtgtggaatgaatcctggtttttaagaagagaccttggcatttactacagtggctgg
caagttctggattcgacaccacaggaggaaagccaaggaatatatcagtgtggaccaaca
tctgtgattgcagtgaaagaaggagatacacacttgggttttgatactccttttgtgttt
gcggaggttaatgctgatcgagaaacctgggttgttcaaaaggatggaactaaggaaaag
gcccataatgacactaaatatattggccaaagcatcagcaccaaggcagtgggaagtgac
gctcgggtggatattacaaacaactacaaatatccagaaggttctccacaagaaaggcag
gtatttgagaaggctagcagaaacatgcctaactatgtcccccccacggaaaatgttagc
ccaggtcccgataacatgatgaacaggaacagaaatgactcaccaatgcggtcatcaacc
cctacaccaaatgctgacccgaatggaagaccatcatcacctgctttgttctctggctat
ccgtcacaaccatcaaattcagcaaatgcttactggcctgcatctccttcaccaaatcca
ccacaaccttcctattcaacatctgcagggactgatattgctgggaaatttaaactcctc
agccccttagtagtgggagatgacattaacctgcttctgattcttaaaaatcttacacct
tatcacagaccagtcagggttaatcttagcgcttctgctattctctataccggaagacga
atgaatgacttattcacagatcagaagtctttgattatcagcccaaaccaagatgcacat
atttccttgcagataccctactcccattacagcagaggtcttaatgaaggaaacatgatt
caagtggttgccctttgtgaattaccttttggatcgaaaatagtcatcactaaggatctt
gtgctggagaacccaccgattactattaagcctctatctaatcctatgctgcacaaaaca
atgactctggagatccggtttacaaacccacttcaaatggcaatcaccgactgcaccctg
gtggtggaaggcagtggtctggttgacagacaacttctagcagtggtcccctacttgaag
ccaaaagagaaaataaagttcaaggtggagctaacaccatacaggcctggaacaagacaa
ctcatagccaacttcaaatgcaaatatttttcaattaaaggataccagtcgttgaatgtg
gagtcctggtaa

DBGET integrated database retrieval system