KEGG   Nanorana parkeri: 108790052Help
Entry
108790052         CDS       T04897                                 

Gene name
PCSK1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:npr01002]
    108790052 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:npr03110]
    108790052 (PCSK1)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     108790052 (PCSK1)
Peptidases [BR:npr01002]
 Serine Peptidases
  Family S8: subtilisin family
   108790052 (PCSK1)
Chaperones and folding catalysts [BR:npr03110]
 Intramolecular chaperones
  Subtilisin family
   108790052 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert OmpA_membrane
Motif
Other DBs
NCBI-GeneID: 108790052
NCBI-ProteinID: XP_018415732
LinkDB All DBs
Position
Unknown
AA seq 736 aa AA seqDB search
MEGKCWPYKYIALVCVFSCCLGLVAAVERRYVNEWAAEIPGGPEEARALATELGYDYAGQ
IGSLQNHFLFRHREHPRRMRRSAPHITKRLSDDDRVSWAEQQYIKQRTKRGYVMKTDSEN
LFNDPMWKSQWYLRDTRVNPTLPKLDLHIIPVWRKGITGKGSVITVLDDGLEWNHTDIYA
NYDPEASYDFNDNDKDPFPRYDITNENKHGTRCAGEVAMVANNNKCGVGVAFNAKVGGIR
MLDGVVTDAIEASSIGFNPQHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRNGK
GSIYVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGD
YTDQRIISADLHNDCTETHTGTSASAPLAAGIFALALEQNPNLTWRDMQHLVVWTSEYDP
LANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKRFKSVPEKKICIVKDSDFEPRLF
RSVDEITIEIPTKACEGQDNYIKSLEHLQLEATIEYTRRGDLHITLTSPSGTRTVLLTER
ERDTSTNGFKNWAFMSVHTWGEDAAGTWTVKITDVSKRLENEGRIVNWKLILHGTSTRPD
HMTHPRVYTSYNVVQNDRRGVEKMTNIQEETSNVKLATEKPTENDETEDTVKSEAMLRLL
KNAFDREGSLLTEEQAKIPNNHYYQALEKLNKQSDAKNRVNSLYSDYIDRFYNSKPYKHR
DDLLLQALLNIVDKDS
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaaatgctggccctacaagtacattgctttagtgtgtgtcttctcatgctgc
ttaggattagtggctgctgtagaaaggcgatatgtgaatgaatgggctgcagagatccct
ggaggtccagaggaagctcgggcattggccactgaattgggctatgactacgctgggcag
attggatcacttcaaaatcattttctattcagacatagggaacaccccaggagaatgcgg
agaagtgctccacacattacaaagcggttatctgatgatgatcgggtttcgtgggcagaa
cagcagtatatcaagcaaaggacaaagagaggctatgtgatgaagacagactcagaaaac
ctttttaacgatcctatgtggaaaagtcagtggtatttgagagacacaagagtcaaccca
acgttgccaaagctggatttacatatcataccagtctggaggaagggaataactggaaaa
ggcagtgttataacagttctcgatgatgggctggaatggaaccatacagatatctatgca
aattatgatccagaagcaagttatgactttaatgataatgacaaagatccgttcccaaga
tacgacattacaaatgagaacaagcatggaacaagatgtgcaggagaagttgcaatggtt
gcaaacaacaacaaatgtggagttggtgttgcttttaatgccaaagtaggagggattcgg
atgttagatggagttgttactgatgccattgaagcaagttccattggatttaatccccag
catgtagacatttatagtgccagctggggaccaaacgatgatggaaaaacagtggaaggc
cctggaagattagcacaaaaggcctttgagtatggcatcaaacagggccgaaatggaaaa
ggctcgatttatgtgtgggcttcgggtaatggtggcagacagggagataactgtgactgt
gatggatacacagacagtatttacaccatctcaatcagcagtgcgtcacagcaaggacta
tctccctggtatgcagagaaatgttcctccacattagccacagcatacagcagtggagac
tacactgatcagaggattataagtgctgatctacataacgactgcacagaaacacatact
ggcacctctgcctccgctccattggctgctggcatcttcgctcttgctctggaacaaaat
cctaatcttacatggagagatatgcaacacctggttgtctggacaagtgagtacgaccct
ctagctaataatcctggctggaagaagaacggagcgggtcttatggtcaatagtcgcttt
ggatttggactactgaatgctaaggcccttgtggatttagctgatcctaaaagatttaaa
tctgtgccagagaagaaaatctgcattgttaaagacagtgactttgaacccaggcttttt
agatcggtggatgaaattacaattgagatccccacaaaggcatgtgaaggccaagataat
tatatcaagtctctggaacatttacaactggaagccactattgagtatacacgccgagga
gaccttcatattacactaacttctccatcaggaaccaggacagttctcttgactgaaaga
gaaagagacacatcaactaatggttttaaaaactgggcttttatgtctgtccatacctgg
ggagaagacgcagcaggaacctggactgtcaaaatcactgatgtgtctaaaagattagaa
aatgaaggaagaatagttaactggaagctgattctgcatggaacatctacccgcccagac
cacatgacccatcccagagtgtatacttcttataatgtggttcagaatgaccgaagaggt
gtcgagaagatgacaaatattcaagaggaaacttccaatgtaaaattagctacagagaag
ccaacagaaaatgatgaaacagaggatactgtgaaatcggaagccatgctgcgtcttcta
aagaatgcctttgacagagaagggtctttacttacagaggaacaggctaaaattcccaat
aaccattattatcaggctctggaaaaacttaacaagcagtcagatgcaaagaacagggtg
aacagtctatacagtgactatattgaccgattctataatagcaaaccctataagcataga
gatgatcttttattgcaagcgctcctaaatattgtagacaaggattcatag

DBGET integrated database retrieval system