KEGG   Nanorana parkeri: 108790539Help
Entry
108790539         CDS       T04897                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04020  Calcium signaling pathway
npr04114  Oocyte meiosis
npr04140  Autophagy - animal
npr04261  Adrenergic signaling in cardiomyocytes
npr04270  Vascular smooth muscle contraction
npr04310  Wnt signaling pathway
npr04340  Hedgehog signaling pathway
npr04371  Apelin signaling pathway
npr04530  Tight junction
npr04540  Gap junction
npr04910  Insulin signaling pathway
npr04912  GnRH signaling pathway
npr04914  Progesterone-mediated oocyte maturation
npr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108790539
   04310 Wnt signaling pathway
    108790539
   04340 Hedgehog signaling pathway
    108790539
   04371 Apelin signaling pathway
    108790539
   04020 Calcium signaling pathway
    108790539
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108790539
  09143 Cell growth and death
   04114 Oocyte meiosis
    108790539
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108790539
   04540 Gap junction
    108790539
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108790539
   04912 GnRH signaling pathway
    108790539
   04914 Progesterone-mediated oocyte maturation
    108790539
   04916 Melanogenesis
    108790539
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108790539
   04270 Vascular smooth muscle contraction
    108790539
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108790539
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:npr03019]
    108790539
   03036 Chromosome and associated proteins [BR:npr03036]
    108790539
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     108790539
Protein kinases [BR:npr01001]
 Serine/threonine kinases: AGC group
  PKA family
   108790539
Messenger RNA biogenesis [BR:npr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     108790539
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    108790539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 108790539
NCBI-ProteinID: XP_018416324
LinkDB All DBs
Position
Unknown
AA seq 385 aa AA seqDB search
MSALQKLENFASRVFSRGPRSPAPGREPGPPASPPAPSLPSNVLSWDREMKEFLAKAKED
FLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVRHKENGNHYAMKILDKQKVVKLKQI
EHTLNEKRILQAVNFPFLVRLDYSFKDNTNLYMVMEYVAGGEMFSHLRRIGRFSEPHARF
YASQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYL
APEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDL
KDLLRNLLQVDLTKRFGNLKNGVNDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTS
NFDDYEEEEIRISITDKCSKEFSEF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccctacagaagttggagaactttgcttcgcgggtcttcagccgtggcccccgt
agtccagctccggggagggagccggggcctcctgccagtcctccagcgcccagcctgccc
agcaacgtgctaagctgggatcgggagatgaaagaattcttagccaaagcaaaggaggac
tttttgaagaaatgggaaaacccagcacagaacacggctcatttggaccagtttgaacgc
attaagactctgggcaccggctcgtttggacgagtgatgctcgtcagacataaggagaat
gggaatcactatgcgatgaagatcctggacaagcagaaggtggtgaaattgaagcagatc
gagcacacgctgaatgagaagcggatcctacaggctgttaatttcccttttcttgttcgc
ttggactattcattcaaggacaacactaacctgtacatggttatggaatatgtagcaggg
ggcgagatgttttctcacttgcgccggatcggacgcttcagtgaacctcacgcccgattc
tatgcatctcagattgtattaaccttcgagtacctgcactccttggatctaatctataga
gacctgaagccagaaaacctgctcatagaccagcaaggttacatacaggtgacagatttt
ggttttgccaagagagtcaagggaagaacttggactctgtgtgggaccccggagtacctg
gctcctgaaatcattctcagcaaggggtacaataaagccgtggactggtgggcgctcggt
gtcttgatttatgagatggctgcaggttaccctccattctttgcagatcagccgattcag
atctatgaaaagattgtatctgggaaggtacgcttcccttcccacttcagctctgacctg
aaggatctcctcagaaaccttttgcaggttgaccttaccaaacgatttgggaatctgaag
aatggggtgaacgacatcaagggccataaatggttcagcaccacggactggattgcagtc
tatcaaaagaaggtggaggcgcctttcatacccaaatgcaaagggccaggcgacacaagt
aattttgatgactacgaagaggaagagatcagaatctccattacagataaatgctccaaa
gaattctccgagttctga

DBGET integrated database retrieval system