KEGG   Nanorana parkeri: 108790571Help
Entry
108790571         CDS       T04897                                 

Gene name
ME1
Definition
(RefSeq) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
npr  Nanorana parkeri
Pathway
npr00620  Pyruvate metabolism
npr01100  Metabolic pathways
npr01200  Carbon metabolism
npr03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    108790571 (ME1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    108790571 (ME1)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     108790571 (ME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 108790571
NCBI-ProteinID: XP_018416363
LinkDB All DBs
Position
Unknown
AA seq 633 aa AA seqDB search
MLTASALSVLTPGNTHLALQQLTIEKAPVQSYITTAIHCHCLLSGPVPAMSSLVVKKDQQ
GKEQHDSQTFMYTRKRGYDITRDPHLNKGMAFSLEERLQLGIHGLLPPCFLSQDVQVLRV
LRNYERQKNDLDRYILLMGLQDRNEKLFYKVLTSDIERFMPIVYTPTVGLACQQYGLAFR
RPRGLFITIHDRGHLSTVIKSWPEDNIKSVVVTDGERILGLGDLGSYGMGIPVGKLALYT
ACGGVKPQECLPVMLDVGTDNEELLKDPLYIGLRHKRVRGKPYDDLLEEFMKAVTDRYGM
TCLIQFEDFANANAFRLLNRYRNQYCTFNDDIQGTAAVAVAGLLAALRITKNKLSGHTVL
FQGAGEAAMGIADLIIMAMEKEGTTREDAVKKIWMVDSKGLIVKGRSSLTHEKERFAHSH
KEMKSLADVVKDIKPTALIGVAAIAGAFTEQILKDMAVLNDQPIIFALSNPTSKAECTAE
QCYALTEGRGIFASGSPFDPVTLPDGRTLYPGQGNNSYVFPGVALGVVACGMRHISDDVF
LATAEIIADQVSDEHLKEGRLYPPLQTIKEVSVKIAVKIVENAYKHNTASVFPEPSDKEA
FVRSHMYSTEYDQFVEDSYSWPDEAMKVQTVTL
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgctcacagcttcagctctgtcagtactaacaccgggcaacacacacctagcattacaa
caactcacaatagagaaagccccagtgcaatcatatattactacagctattcattgccac
tgcttgctgtctggaccagtaccagcaatgtcttctctggtggtaaaaaaggatcaacaa
gggaaggagcagcatgacagccagactttcatgtacaccaggaagagaggctatgatata
acccgggacccgcatcttaacaagggtatggcgttctctctggaagagagactacaactg
ggtatccatggccttcttcctccttgttttctcagtcaagatgtccaggttttgagagtg
cttcgaaactacgagaggcagaaaaatgaccttgataggtatatcttgttgatgggactg
caagatcggaatgaaaagctgttttacaaagttttgacatctgacattgagagattcatg
cctattgtttatactcccacagtaggcttagcttgtcaacagtatggcttagcgttccga
agaccaagaggcctctttattacaattcatgatcgtggtcatctatccacagtaataaaa
tcatggcctgaggacaacattaagtctgttgtagtgactgatggagagaggatccttggt
ctgggggatcttggaagttatgggatgggaattcctgttggcaagctggcactttataca
gcatgtggaggagtaaagcctcaggagtgtctacctgttatgttggatgtaggaactgat
aatgaggagttactaaaagacccgttgtatattggactaagacacaaaagagtaagagga
aagccttatgatgaccttctggaggaatttatgaaagctgtaactgacaggtatggtatg
acctgcctcatccagtttgaagattttgctaatgccaatgcctttcgcctactgaacaga
tatcgtaatcagtactgcacgttcaacgatgatattcaaggcactgcagctgttgcggta
gccggactccttgcagcacttcgtattacaaagaataaactatccggtcacacagtactt
ttccaaggagcaggagaggctgctatgggaattgcagacttaataattatggccatggag
aaagaaggtacaaccagagaagatgcagttaagaaaatctggatggtggattctaaaggg
ctgatagtaaagggtaggtcttctcttacccatgaaaaggagcgctttgcccattcacac
aaggaaatgaagagtctggcagatgttgttaaagatatcaaaccaacagctttaataggc
gttgcagctattgctggagcttttactgagcagattttgaaagacatggctgttttgaat
gaccaaccaattatattcgccctcagcaatccaacaagtaaagcagagtgcactgcagaa
cagtgttatgccctgactgagggccgtggaatttttgcaagtggaagtccttttgatccc
gtcacgcttccagatggacgaacactttatcctgggcagggaaacaattcctatgtgttc
ccaggtgtggcccttggtgttgttgcatgtggcatgaggcacataagtgatgatgttttt
ctggccactgctgagatcatagctgatcaagtttcagatgaacatttgaaagaaggacgt
ttgtatccacctttgcaaacaataaaggaagtctcagttaagatagctgtcaagattgta
gagaatgcgtacaaacataacacagcgtctgtctttccggaaccttcagataaggaggca
tttgtccgatctcatatgtacagtactgagtatgaccagtttgtggaggattcctactcc
tggccagatgaagctatgaaagttcagacggtcacactgtaa

DBGET integrated database retrieval system