KEGG   Nanorana parkeri: 108791265Help
Entry
108791265         CDS       T04897                                 

Gene name
ITGB5
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin beta-5
  KO
K06588  integrin beta 5
Organism
npr  Nanorana parkeri
Pathway
npr04145  Phagosome
npr04510  Focal adhesion
npr04512  ECM-receptor interaction
npr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    108791265 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108791265 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108791265 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108791265 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:npr04131]
    108791265 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:npr04515]
    108791265 (ITGB5)
Membrane trafficking [BR:npr04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    108791265 (ITGB5)
Cell adhesion molecules [BR:npr04515]
 Integrins
  Integrin beta subunits
   108791265 (ITGB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt EGF_2 I-EGF_1
Motif
Other DBs
NCBI-GeneID: 108791265
NCBI-ProteinID: XP_018417201
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MISVSRGRVCRSHSHSDVSISVQDYGGSRTVVSRCDLMENLLSKGCRAESIEGPKSRVTV
TKKLPLSSKGSGSSQSDIIQVTPQSLSVSLRPGNSAQGEITKSLGVFSDLLVPLDXAKSE
IVSPATRLAEEMAKLTSNFRLGFGTFVDKNVSPFSYTAPKYQNNPCTGFKPFPNCIPSFG
FRHVLSLTDKVSKFNAKVQNQLVSRNRDAPEGAFDAVLQASVCKEKIGWRTEASHLLVIT
TDDVPHIALDGKLAGLVQPHDGHCHLNTNNEYSAADQLDYPSLALLGEKLSENNIHLIFA
VTRNHYLLYKNFTALIPGTTVEILDQSSQNILQLIVNAYNSIRSKVELTVSETPEDLELS
VTATCQDGASYPGVKKCGELMIGDTVSFEVSAQARSCPPPGSAHTFTIKPVGFRDALEVT
VTYNCSCGCSHLEEASSGKCSGNGTYTCGVCNCDGGFLGARCECGEDDDSSSSSLNTCRE
SEGHTVCNGRGRCICGLCSCYESEFGRISGSYCQCDDFSCARFKGILCSGHGECDCGECK
CHAGYVGDNCNCTTETSSCVSSDGQMCSGKGNCVCGRCLCVEPGAFGETCDKCPTCPDAC
GTKRXNLRPCVFYLTSVLPFSLLSDLRRCMYTVERRXLISSSSSETDKPEAVQCVYKTDN
ECVMRFMYSEEANGKSILSVLKEPECAGAPDALTVLLAVVGSILLIGLVLLAVWKLLVTV
HDRREFARFQSERSRAKYEMASNPLYRQPISTHNMDEVYSMMGKSYNGTSNGYSGESDNY
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgatttctgtgtctcgggggagggtctgtcggtcacactcacattctgatgtctctata
tctgtgcaggactatggagggtcccggacggtggtgtcgcgctgtgacctgatggagaat
cttctcagtaagggctgcagagccgagtctattgagggccccaaaagcagagtcaccgta
acgaagaaacttcctctcagcagcaaaggctccggctcatcccaatccgacatcatccag
gtcaccccacagagcctctccgtgtccctgcgacccgggaactcagcacagggagagata
actaagtcattaggcgtcttcagtgatttgttggttcctctggactaagcaaagtcagaa
attgtctccccggcaacgcggctggcggaagagatggcgaagctcaccagcaatttccgg
ctcgggttcggcactttcgtggacaagaacgtctccccgttctcctacacggcccccaaa
taccagaacaacccctgcaccggattcaaaccgttcccgaactgcattccgtccttcggc
ttccggcacgtcctctcgctcaccgacaaagtcagcaagttcaacgccaaagtgcagaac
cagctcgtgtcccgaaaccgcgacgcccccgaaggagccttcgatgccgtcctgcaggcc
tccgtgtgcaaagagaagatcggctggagaacggaggcgtcccacctgctggtcatcacc
accgacgacgtgccgcacatcgcgctggacgggaaactggccggactggtgcagccgcat
gatgggcattgtcacctgaacaccaacaacgagtacagcgccgccgatcaactggattac
ccgtctctcgctcttctgggggagaagctgtctgagaacaacatccatctgatatttgcc
gtcacccgaaatcattatctgctgtacaagaatttcacggcgctgattccgggaaccacg
gtggagattttggatcagagttcccagaacatcctccagctgatagtaaatgcttataat
agtattcgctccaaggtggaactaaccgtctcggagacccccgaggacctggagctcagc
gtcaccgccacgtgtcaggatggagcgtcctatccgggcgtgaagaaatgtggagagctg
atgattggcgatacggtttccttcgaggtctcggcacaggcgaggagctgccctccgccg
gggtcggcgcacaccttcaccatcaagccggtgggtttccgggacgcgctggaggtgacg
gtgacctataactgcagctgcggctgttctcacctggaggaggcgagcagcgggaagtgc
agcggtaacggaacgtacacctgcggggtctgcaactgcgacggcggcttcctgggcgcc
aggtgcgagtgcggcgaggacgacgacagcagcagctcgtctctgaatacctgccgggag
tcggagggccacaccgtctgcaacgggcgggggaggtgcatctgcggcctgtgctcgtgc
tacgagagcgaattcgggcgcatcagcggctcctactgtcagtgtgacgacttctcatgt
gccagattcaaagggatcctctgctcaggtcacggcgaatgtgactgcggcgaatgtaag
tgtcacgccggctacgttggcgacaactgcaactgcactacggagaccagcagctgcgtg
tccagcgacgggcagatgtgcagcggcaaagggaactgcgtgtgcggccgctgcctgtgt
gtggagccgggggcgttcggggagacctgcgacaaatgccccacctgccccgacgcctgc
gggacaaaaaggtaaaatctccgaccctgtgtcttctatctgacctccgtcctccccttc
agtcttctatctgacctccgacgttgtatgtacacggtggaacgtcggtaattgatttcc
tcttcctcctcagagactgacaagccggaggccgtgcaatgcgtctataagacggacaac
gaatgtgtcatgcggttcatgtactcggaggaggcgaacggcaaatccatcctgagcgtc
ctgaaggagccggagtgcgcgggggctccggacgccctgaccgtcctcctggcggtggtg
ggaagtatattgctgatcggactcgtccttctggccgtctggaagcttctcgtcactgtt
cacgatcggcgcgagtttgcgcgctttcagagcgagcgctccagagccaagtatgaaatg
gcgtccaacccgctctaccggcagccgatctccacccataacatggacgaggtgtacagc
atgatgggaaaatcctacaacgggacctcgaacggctacagcggggagagcgacaactac
taa

DBGET integrated database retrieval system