KEGG   Nanorana parkeri: 108791352
Entry
108791352         CDS       T04897                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04210  Apoptosis
npr04620  Toll-like receptor signaling pathway
npr04621  NOD-like receptor signaling pathway
npr04622  RIG-I-like receptor signaling pathway
npr04623  Cytosolic DNA-sensing pathway
npr04625  C-type lectin receptor signaling pathway
npr04920  Adipocytokine signaling pathway
npr05132  Salmonella infection
npr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108791352 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108791352 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108791352 (IKBKG)
   04621 NOD-like receptor signaling pathway
    108791352 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    108791352 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    108791352 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    108791352 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108791352 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108791352 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108791352 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108791352 (IKBKG)
Protein kinases [BR:npr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   108791352 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO Filament Polo_box_3
Other DBs
NCBI-GeneID: 108791352
NCBI-ProteinID: XP_018417322
LinkDB
Position
Unknown
AA seq 558 aa
MSARGQTGEMVQTKDGPEDGSLGKTETLPPEVSSPEAIQRLWIENQDLRVALEQSNAMLR
KSHSEMVEIQTAQRQERTFIAYKFSEAKNLVQRMTKERDSLHAQLAAAKKPLAEVTSRDG
QTATNDRAATEEPVCPYSAQKKGFEEANSPGSSLSYCETLTPSMCEVIRESARHHQGPPR
AEQVRAPIFYDDIIMESERNRLLESPATDLVRIREERAFRKAVTEIEVLQGQDERSTERE
QDLQKKLQEAESRNAQLQEKITALQLEVSNLKDQLKDKGVEAQRQLQLLAEEKASVKAQV
TSLLGELKESQMSLETSQMEKRKVQESLRTLKDQHREWELQMKQHVIQMDQKRMQVQNLE
TALKVERQNASEEMRKLAQLQAAYHKLFQEYDAHIKNGLHQEKLMKGMDLQLQELKQQLQ
EAEEALVAKQELIDKLKIETDEQKSLKETIVLLRAQADIYCADFQAERQARERLHAEKEQ
LQEQLDELKREWTRMEEMKNRHAESVRPNQPSIYPLPYSVPTASFHTMVEPQEYRCPKCQ
YKAPDMDTLQIHVMDCIQ
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgagcgctcgagggcagacgggtgaaatggttcaaacaaaggatggccctgaggacggg
tctctggggaaaacggagactctgccgcctgaagtatccagtcccgaggccattcagcgc
ctgtggattgaaaaccaggacttgagagtggccttggaacagagtaatgcaatgttgcgg
aaaagtcacagcgagatggttgagattcagactgcgcagagacaggagagaacgttcatt
gcgtacaagttcagcgaggccaaaaaccttgtacagagaatgacaaaggagcgggattct
ctgcacgcccaactcgcagcagccaaaaagccgctagctgaggtgacatctagggatggg
caaactgcaacaaatgacagagctgccacagaggaaccggtttgtccctacagtgctcag
aagaaaggcttcgaagaggctaacagccctgggagctctctgtcctactgtgaaacgcta
acccccagtatgtgtgaagtcatcagagagtcagcacgacatcaccaggggccaccccga
gctgagcaggtgagagctcccatcttttacgatgatatcataatggaaagtgaaaggaat
cgacttcttgagtcaccagctacagacttggtcaggattcgggaggaacgcgccttccgg
aaggcagttacagaaatagaagtcctgcaaggtcaagatgaaaggagtacagaaagggag
caggatctgcaaaagaagctccaggaggcagagagtcggaatgcacagctgcaggaaaag
attactgcgctgcagctggaggtgtcaaacttgaaagaccagctgaaagacaaaggggtc
gaagctcaaagacagctccagctactggctgaggaaaaggcttctgtcaaggctcaggtg
acctctttacttggagagttaaaggagagtcagatgagcctggagacctctcagatggag
aagaggaaggtgcaagaaagcctgcggacattgaaagatcagcaccgagagtgggagttg
cagatgaagcagcatgtgatacagatggaccagaagaggatgcaggtgcagaatctggag
acagcactgaaagtggagcggcagaatgccagtgaggagatgagaaagctggcccaactt
caggctgcatatcacaagctatttcaagaatacgatgcacacatcaagaatggccttcac
caagaaaaactcatgaagggcatggaccttcagctgcaagaactaaagcaacagctgcag
gaggcagaagaggctttagtagccaaacaagaactcatagacaaactaaagattgaaacg
gatgagcagaagagcctgaaagagacaattgtcctgctcagagcccaggcagatatttat
tgtgcagatttccaggcagagcggcaggcaagggaacggctccatgcagaaaaggagcag
ctgcaggaacaactggatgaactaaagagagaatggactaggatggaagagatgaagaac
aggcatgctgaaagtgtacgaccaaaccaaccatcaatctaccctctgccatactctgtt
ccaactgcttcctttcatactatggtagaacctcaggagtatcggtgccccaagtgtcag
tacaaagccccagatatggacacgctgcagattcatgtcatggattgcatacagtag

DBGET integrated database retrieval system