KEGG   Nanorana parkeri: 108791575
Entry
108791575         CDS       T04897                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04020  Calcium signaling pathway
npr04260  Cardiac muscle contraction
npr04261  Adrenergic signaling in cardiomyocytes
npr04270  Vascular smooth muscle contraction
npr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108791575
   04020 Calcium signaling pathway
    108791575
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108791575
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108791575
   04261 Adrenergic signaling in cardiomyocytes
    108791575
   04270 Vascular smooth muscle contraction
    108791575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:npr04040]
    108791575
Ion channels [BR:npr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108791575
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 108791575
NCBI-ProteinID: XP_018417595
LinkDB
Position
Unknown
AA seq 2179 aa
MFHTFIRQAKASYRPMPNNMAPRPSVFCKGNVVSETEMDYVHVAPGGSNYTNPLPALGTM
NSTTGLATEHIPTPGAALSWQAAIDAARQAKLMGSAANATISTVSSTQRKRQQYIKQKKQ
GASSATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDS
NATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAIL
EQATKADGGSALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIA
LLVLFVIIIYAIIGLELFMGKMHKTCYFLANKDVPAEEEPSPCALISNNGRHCPNETICE
SGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENED
EDIDEDKPRNMSMPTSETESVNTDNVGSGDVDEEGCGVRLAHRISKSKFSRYWRRWNRFC
RRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTVNKVLLALFTAEMLL
KMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRY
WNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFP
QALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAV
DNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENETIGKSPVPAVEENKEKIELKAI
TADGESPPTTKINVEDYPSNENDEKSPYPSSNENPGEEEEEEPEMPVGPRPRPLSELHMK
EKAVPMPEATAFFVFRPDNKFRLHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRNYSF
RNQVLYYFDIVFTAIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQS
SAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGV
QLFKGKLYSCTDSSKITEAECRGKFISYKDGDVSQPMVQERRWENSKFDFDNVLAAMMAL
FTVSTFEGWPELLYRAIDSHTEDIGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVT
FQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVL
ILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDF
LIVIGSVVDVILSETSHYFCDAWNTFDALIVVGSIVDIAITEINTGEHSQCHNMQGEENS
RISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQV
FGKIALNDTTDINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPNKMCEPDSEDPPIM
EDFSCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWA
EYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATL
FALVRTSLCIKTDGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATF
LIQEYFRKFKKRKEQGLVGKPSQRTALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKA
MKEAVSAASEDDIFRRAGGLFGNHVGYYQSEVRSAFPQTFTTQRPLHINKTSASPGDIDS
PSHEKLVDSTFTPSSYSSSGSNANINNANNTALVRLPNLPAYQSMVSTVEGQSRPLRTHG
SWKISSKSSVSRDSRLPIICREEASQDETYDASEEVEYNSEPSLLCSDMFTDRDEESRQL
TPSEGEVERGLCPSPKRSFLRSASLGRRASFHLECLRRYRNQGGDTSPKAVLPQLHLVHH
QALAVAGLSPLLRRSHSPTAFSRLCSTPPTTPCSRGWAQQTVPAVRLHADPGSKENFHSS
FPSVHCSDCSLERDRPVSLTVPCHVREQTRQHHGSASSLVEAVLISEGLTQFAQDPHFLQ
VATHELADACDMTIEEMESAADSFLNSNPSPNRKLSPFPKRRDQVVECAGGGSEEPELSP
GCRNSKGEPEDCRVYMSSP
NT seq 6540 nt   +upstreamnt  +downstreamnt
atgtttcacaccttcatccgccaggccaaagcttcttaccggcctatgcccaacaacatg
gctccacggcccagcgtgttctgcaaaggcaatgtagtctctgagacggagatggactac
gtccacgtggctccaggaggctctaactacacaaaccctcttccggcattgggcaccatg
aactccaccactggcctcgccacagagcatatccccacccctggcgctgccctctcctgg
caagccgccatcgatgccgcccggcaggccaagttaatgggcagcgccgccaacgccacc
atatccaccgtaagttccacgcagaggaagaggcagcagtacatcaagcaaaaaaaacag
ggagccagctcggcgacacggcccccgcgggcgctactctgtctcaccctcaaaaacccc
atccgccgcgcctgcatcagcatcgtggagtggaaacccttcgaaatcattattttgctg
actatttttgccaactgtgtggccttagcagtctatatccccttccccgaggacgactcc
aacgccaccaactccaacctggagcgggtggagtacctcttcctcatcatcttcaccgtg
gaagctttcctcaaagtcatcgcatacgggcttctctttcaccccaacgcatacctccgg
aatggctggaacttgctggatttcatcatcgtggtcgtagggctttttagtgcaatttta
gaacaagcaacaaaggcggacggcggcagtgccctcggagggaaaggggcggggttcgac
gtgaaggcactacgagcattcagagtgctgagacccctaagactggtgtctggggtaccc
agtcttcaggtggtgctaaattctatcattaaggccatggtgccgctgctgcacatcgcc
ctgttggtgctgttcgtcattatcatctacgccattatcgggctggagctgttcatgggc
aagatgcataaaacctgctacttcctggctaacaaagatgtccctgcagaggaggagccc
tcgccctgcgccctcattagcaataatggacgccactgtcccaacgagaccatctgcgag
tccggctgggatgggcccaagcatgggatcaccaattttgacaactttgcattcgccatg
ctcaccgtctttcaatgcattaccatggagggctggacggacgtgctctactggatgcag
gacgccatgggatacgaactgccctgcgtgtacttcgtcagccttgtcatctttgggtcc
tttttcgttctgaacctggttcttggtgtgttgagcggagagttttccaaggagcgagag
aaggccaaggctcggggtgacttccagaaattaagagagaagcaacagctggaagaagac
ctgaagggatatctagactggatcacgcaggccgaggacatcgatcccgagaatgaagac
gaggacatagatgaggacaagccacggaacatgagcatgccgaccagtgagactgagtct
gtgaacaccgacaacgtaggcagtggcgatgtggatgaggagggctgcggagtccggttg
gcgcacagaatttccaagtctaaatttagccgttactggcggcgctggaaccggttttgt
cggcgaaagtgccgggcggcggtgaagtccaacgtcttctattggctggtgatatttctg
gtattcctgaacacgctgaccatcgcttccgagcactacaaccaacccgactggctgacc
gaagtacaagacacggtaaacaaagtcctcctggcgctcttcaccgctgagatgctcctg
aagatgtacagtctggggctccaggcgtacttcgtctccctcttcaaccgtttcgactgt
ttcatcgtctgtggggggatcctggaaaccatattggtagagaccaaaatcatgtcccct
ttgggcatctccgtcctgcgctgcgtgcgtctcctcaggatattcaagatcaccaggtac
tggaattccctcagtaatttggtggcctctctgctgaattccgtgcgctccatcgcctcc
ctgctgctcctcctctttctcttcatcatcatcttctctctgttggggatgcagctcttc
gggggaaagttcaacttcgacgagatgcagacccgccgcagcaccttcgacaactttccg
caggccctgcttactgtcttccagatcctcaccggagaggactggaattcagtgatgtac
gacgggatcatggcgtatggcggaccctcatttcccgggatgcttgtctgcatctacttc
atcatcctcttcatctgtggaaactatatcctgctaaatgttttcttggccattgctgtg
gacaatttggcagatgcagaaagtttgacctctgctcagaaggaagaggaggaagagaag
gagaggaagaaactggcccgaacggcgagcccggagaagaaacaagagaacgagacgatt
ggaaaatctccggtgccggcggtggaggaaaacaaagagaagatcgaattgaaggccatc
accgcagatggcgagtcacctcctactaccaagattaatgtggaagattatccctccaac
gaaaacgatgagaagtctccatatcccagcagcaatgaaaacccaggggaggaggaagag
gaggagcctgagatgcctgttggtcctcgaccccgcccactttctgaactgcacatgaag
gagaaggctgttcccatgcccgaagccaccgctttctttgtcttccgtccagacaacaag
ttccgcctccactgtcaccgtattgtcaacaacaacatcttcaccaacctgatcctcttc
ttcatcctcctgagcagcatctcgctggcagccgaagaccccgtgagaaactactccttc
aggaaccaagtcctctattattttgacatagtctttaccgccattttcaccatagagata
gccctgaagatgacggcctatggcgcattcttgcacaagggctccttctgcaggaattac
ttcaacatcctggacctgctggtggtcagcgtgtcgctcatctcctttggcatacagtcc
agcgccatcaacgtggtgaagattttgagggtcctcagagttctgcggccactcagagcc
atcaacagagccaaaggtctcaagcatgtggtccagtgcgtcttcgtcgccattcgcacc
atcggaaacattgtcattgtcaccactctgctccagtttatgttcgcctgcatcggagta
cagctgttcaagggcaagttgtacagctgcacagacagctcaaagattacagaagccgag
tgcagggggaagttcatctcctacaaagacggggatgtgtcgcagccgatggttcaggag
cggcgatgggaaaacagcaagttcgacttcgataacgtcctggcggcaatgatggcgctc
ttcaccgtctccacctttgaaggctggccggaactgctgtacagagccatcgactcccac
acagaggacattggacccatctacaaccaccgcgtggagatctccatcttcttcatcatc
tacatcatcatcatcgccttcttcatgatgaacatcttcgtcggtttcgtcatcgtgacc
ttccaggagcaaggagagcaggagtacaagaactgtgagctggacaagaaccagcgacaa
tgtgtggagtacgccttgaaggcccgccccctgcgcaggtacatccctaagaaccagtac
caatacaaggtgtggtacgttgtcaactcgacctattttgagtacctcatgttcgttctg
atccttctcaacaccatctgtctggcaatgcagcattatgggcagagctgctccttcaag
gaagccatgaacatcctcaatatgctgtttacaggcttgttcacggtggagatgatcctg
aaactcattgcttttaaaccaaagggttattttagtgacccctggaatgtctttgacttt
ctcatcgtcattggcagcgtagttgacgtcatactcagcgagaccagtcactatttctgt
gatgcatggaacacatttgatgcacttatagtagtgggtagcattgttgatatagcaatc
accgaaataaacacaggtgaacactctcaatgccacaatatgcagggtgaggagaactcc
agaatctccatcacattcttcaggctctttcgagtcatgcgtctggtgaagcttctcagc
cgaggagagggaatccgcaccctgctctggaccttcatcaagtctttccaggctctcccc
tatgtggctcttctcattgtaatgctgtttttcatctatgctgtgattggaatgcaagtt
tttgggaaaattgctctaaacgacacaacggatattaacagaaacaataattttcagacc
ttccctcaagctgttctgctgctcttcagatgtgctaccggagaagcatggcaggaaatc
atgttggcttgtctccccaacaagatgtgtgagccggattctgaagatccccccatcatg
gaggacttctcctgtggcagcagcttcgctgtcttttactttatcagcttctacatgctc
tgcgctttcttgatcatcaatttgtttgtcgcggtcattatggataattttgactatctg
acgcgagattggtccatattgggccctcatcatttggatgaattcaagcgaatctgggca
gagtacgatccagaggccaaggggcgcatcaagcacctcgatgtagtgacccttctacga
cgaatacagccccctctgggttttggaaagctgtgcccacaccgtgtggcgtgtaagcgt
ctggtcgccatgaacatgcctctgaacagcgatgggacagtcatgtttaacgcaactctc
ttcgctttggttcggacttctctatgcatcaaaactgatggtaacctggaacaggccaat
gaggaactccgagctatcgttaagaagatctggaagaggaccagtatgaaactgttggac
caggtggtgccgccagctggtgatgacgaggtcactgtggggaagttttacgccaccttc
ctgattcaagaatacttccgcaagttcaagaagcgcaaagagcaggggcttgtgggaaaa
ccatcgcagcgcaccgctctctccctgcaggccggactgcgcacactgcacgatattggg
cctgagattcggcgtgctatttccggagatctgaccgcggaggaggagctggacaaagcc
atgaaggaggcggtgtcagcggcgtctgaggacgacatcttccggagggcgggaggattg
tttgggaatcacgtaggatactatcagagcgaggtgcgaagtgcattccctcaaaccttc
acaacgcagagaccattacacatcaacaagacatctgctagtcctggggatatagactca
ccttctcatgagaaactggtggactccaccttcacacccagcagctactcgtcctccgga
tccaatgccaacatcaacaatgccaacaacacggccctagtacgtcttcctaatctgcca
gcctaccagagcatggtcagtactgtagaggggcagagtcgcccgctgcgcacacacggg
tcctggaaaatcagctctaagagttcagtgtcccgggacagccgactgccaatcatctgc
cgcgaggaggcatctcaggatgagacatatgatgccagcgaagaggtggagtacaacagc
gaaccgagcctcctctgctcagacatgttcacagatcgagacgaggaaagccggcaactg
accccgtcagaaggagaagtagagagagggctgtgtccatctcccaaaagaagcttccta
cgttctgcctcgttaggcaggagggcctcattccatttggaatgtctgaggagatacagg
aatcaaggtggggacacgtcacccaaagccgtattaccgcaacttcacctggtgcaccat
caggcattagcggtggccggcctcagtcctctgctacggaggagtcactcgccgacggcg
ttctcccgcctctgttctactccgcccaccacgccctgctcacgagggtgggcacaacag
actgtgccagcagtaaggctacatgcggacccggggtccaaagaaaactttcacagcagc
ttcccatctgtgcactgcagcgactgcagcctcgagcgggaccgtcccgtctcccttaca
gtcccgtgccatgtgcgggagcaaacgcggcagcaccacggcagtgccagcagtttagta
gaagcggtgctgatctcggaaggattgacacagtttgctcaggaccctcacttcctacag
gtggctacgcacgagctggcggacgcctgcgacatgacgatagaggagatggagtcggcc
gctgacagcttcttgaatagcaatcccagcccgaacaggaagctttcccctttccccaaa
cgcagggaccaggttgtggaatgcgcagggggcgggtcagaagagccagaactctctccg
ggctgccggaacagcaagggcgagccagaggactgccgggtatacatgagcagcccatag

DBGET integrated database retrieval system