KEGG   Nanorana parkeri: 108791816Help
Entry
108791816         CDS       T04897                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
npr  Nanorana parkeri
Pathway
npr00480  Glutathione metabolism
npr00980  Metabolism of xenobiotics by cytochrome P450
npr00982  Drug metabolism - cytochrome P450
npr00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108791816 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108791816 (MGST1)
   00982 Drug metabolism - cytochrome P450
    108791816 (MGST1)
   00983 Drug metabolism - other enzymes
    108791816 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:npr02000]
    108791816 (MGST1)
Enzymes [BR:npr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108791816 (MGST1)
Transporters [BR:npr02000]
 Other Transporters
  Pores ion channels [TC:1]
   108791816 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 108791816
NCBI-ProteinID: XP_018417895
LinkDB All DBs
Position
Unknown
AA seq 155 aa AA seqDB search
MSVLKQFADSEVFRAYATYVAVVLLKMMLMSILTSFFRITRKVYANPEDAASISKGGDLK
KYVRTDETVERVRRCHLNDIENIVPFVGLGLVYALSNPDLSTALLHFRIFAGSRILHSIS
YLTPLPQPSRALTFLVGYIVNVSMAYATLRSIFYF
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcttaaagcagttcgctgacagtgaggtgttcagggcctatgctacatatgtg
gctgtggtcctcttgaaaatgatgcttatgagtattcttacctccttcttcaggattaca
cgcaaggtctatgcaaatccagaagatgctgctagtattagcaagggaggagatctgaaa
aaatatgtcagaacagatgaaactgtggagagagttcgcaggtgtcatctgaacgacatt
gagaacattgtaccatttgtgggacttggtctggtctacgctctcagtaatcctgattta
tccaccgcgcttttacatttccgtatctttgctggttctcgcattctgcacagcatctcc
tacctgacgccactgccgcagccaagtcgagcgctgaccttcctcgttgggtacatcgtc
aatgtctccatggcctatgcaactctgcgcagcatcttctatttctag

DBGET integrated database retrieval system