KEGG   Nanorana parkeri: 108791911
Entry
108791911         CDS       T04897                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETMAR
  KO
K11433  [histone H3]-lysine36 N-dimethyltransferase SETMAR [EC:2.1.1.357]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108791911
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108791911
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     108791911
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108791911
SSDB
Motif
Pfam: SET Pre-SET NFACT-C
Other DBs
NCBI-GeneID: 108791911
NCBI-ProteinID: XP_018418048
LinkDB
Position
Unknown
AA seq 191 aa
MEPGDVCAGLEAIQVPVCGPWEDLGPFQYTPELTAGPGADPDPSEVTIQGCQCQGQSCAA
EQCPCLPRGENYANGRRLLQTYGDPTRIGNVGRFLNHSCRPNLVMLPVRSHSTVPRLALF
AARRIQEGEELCYDYSGRSFNAEPGEESQSAGEEGGPGPRKRCLCGADVCSGYLPFDGSL
YGGDARKSDPD
NT seq 576 nt   +upstreamnt  +downstreamnt
atggagcccggggacgtgtgtgccgggctggaggccatccaggtgccggtatgcgggccc
tgggaggatctggggcccttccagtacactccagaactgacggccggccccggagcggat
ccagacccgagcgaggtgaccatacagggctgccaatgccagggtcagagctgcgcggcg
gagcagtgcccgtgtctgccgcggggcgagaactacgcgaacggacgccggctgctgcag
acctacggggaccccacccggatcggcaacgtgggccgcttcctgaaccactcctgccgc
cccaatctggtcatgttgccggtgcggagtcactccacggtgcccaggctggcgctgttt
gccgcccgccgcatacaggaaggggaggagttatgttacgactattccgggaggtcgttc
aacgcggaacccggcgaggaatctcagagtgcgggtgaggaagggggcccggggccccgg
aagaggtgcctgtgcggtgcagacgtgtgttccggttatttaccctttgacggttctttg
tatggaggagacgctcggaaatctgatcccgactga

DBGET integrated database retrieval system