KEGG   Nanorana parkeri: 108791991Help
Entry
108791991         CDS       T04897                                 

Gene name
LSP1
Definition
(RefSeq) lymphocyte-specific protein 1
  KO
K14957  lymphocyte-specific protein 1
Organism
npr  Nanorana parkeri
Pathway
npr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108791991 (LSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 108791991
NCBI-ProteinID: XP_018418157
LinkDB All DBs
Position
Unknown
AA seq 409 aa AA seqDB search
MSTSIVRRESKKSLQNLLRLTTQWSVEDEEEAARERRRRERQQQEGGEGQSPDDLDDENC
TQRDNHVELKPAGPWETEEDEGFSDWSQKLVQRKLKGAAQAAEETEEPRFTDEEQTEQTR
ATEEFHTYNTVAQVEEEDEGTTRNEEVEINDELEACREEREATSYNWETREIDYEDNRPP
SPRVPEEEFEEQGEQEEIHVTARDQEQYQNQWVSDEMENRRQSVSSDGEEGDGTLTVKIT
ERAEILNRSIQKSNSIKRSEPPMPIHKIDDRLEQYTHAIETSIKPGRLARQPSLELLSPT
DPVSNIKNRWEIGDVTTAAKASSCKDTEGINIGVSDMINQWGKDKTEPDGQGTPLKLAEV
KPGDVLSKKSLWEQGSKSGQMNKNAASTKKYKFVPVGHGKYEKILVDEP
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctctattgtaagaagagaaagcaagaagagcctgcagaatctactaaggctg
accactcagtggagtgtggaagatgaagaagaagcagcacgggaacgtcgtagaagagag
agacagcagcaggagggaggtgaaggacagtctccagatgacctcgatgacgagaactgc
acacagagagataaccatgtggagctgaagccagctggtccttgggagacggaggaggat
gaaggatttagtgactggtctcagaaactggtgcagaggaagctgaaaggagctgcgcag
gccgcagaggagacagaagagcccagatttacagacgaggaacagacagagcagactaga
gccacggaggagttccatacatacaacacagtagcacaggtggaggaagaagatgaaggg
acaacccgcaatgaagaagtagagataaatgatgaactggaagcctgcagagaagagaga
gaagccacctcttacaattgggaaacaagagaaatagattatgaggataacagaccacca
agtccaagagttcctgaagaagagtttgaagaacaaggggaacaggaagagatacatgtg
actgctagagatcaggaacagtaccagaaccagtgggtatcagatgaaatggaaaatcgg
aggcagtcagtgagcagtgatggagaggaaggagatggtacactcacagtgaagataact
gagagagcagagattctgaatcgctctatccagaaaagtaacagtataaagaggagtgaa
ccacccatgccaatacacaagattgatgaccgtctggaacagtacacacatgctatagag
acgtccattaaaccaggccgcttggctcggcagccatctttagagctgcttagtcctaca
gatcctgtatcaaacataaaaaaccgatgggagattggagacgttactacagctgccaaa
gcatcctcttgcaaggatacagagggcatcaacattggtgtgtcagacatgatcaaccag
tggggtaaagataaaaccgaacccgatggccagggaacccctctaaaactcgcagaagtg
aagccaggagatgtactgagcaagaagagcttgtgggaacagggctccaagtcaggacaa
atgaataagaatgcggcttccactaaaaagtacaagtttgttccagttggacatggaaaa
tatgagaagatcttagtggacgagccttga

DBGET integrated database retrieval system