KEGG   Nanorana parkeri: 108792225Help
Entry
108792225         CDS       T04897                                 

Definition
(RefSeq) proline-rich protein HaeIII subfamily 1-like
Organism
npr  Nanorana parkeri
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 108792225
NCBI-ProteinID: XP_018418462
LinkDB All DBs
Position
Unknown
AA seq 297 aa AA seqDB search
MVEEKASKDSIAPADPPKDPADTKGDWERGAEVQAAQRGDVGEVPEERPQPSQGTAVSLS
PQSMSPANIYAKPEPQHRKETPAGTAPVPRPVVAVAPSNRPAGRRPSYSTRTPGVPVRPH
PTASRRERPIRPGDAQVKGPGSGAPEVTSGRGRTRPYQRWRPRPPRRPQTKPGARLAAPA
NGTERPAAPEAPSLRQHQDRSPTPKHPRNTRRPPPDAEDPGKDPQGHTPRQTGDGGWGRR
GGACGAKASRPISYIPRRMRTRHPPPDRQQRRGHQEKTPQVLCGELAPPTAVAAPAA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggaaaaggcctccaaggatagcattgcgccagcggacccccccaaagacccc
gcagacaccaagggagactgggagaggggcgcagaagtacaggctgcgcaaaggggggat
gtgggagaggtccctgaggagaggccgcagccctcacagggcactgcagtcagcttgtcc
ccacaatccatgtccccggcaaatatatatgccaaaccagagccccagcacaggaaagag
accccagcaggcaccgcccccgtccctaggcctgttgtcgcagttgcccctagcaaccga
cccgcaggcagacgaccctcctacagtacccgaactcccggtgtcccagtgcgtcctcac
ccgaccgcgtcccggcgtgaaagaccgatccggccgggtgacgcgcaagtaaagggaccc
ggaagcggcgcaccggaagtgacgtcaggccgagggcgcacgcgcccataccaaagatgg
cggccgcggcctccgagaaggccgcaaacgaagccgggggctcgattagcggcccccgcg
aacggaaccgagcggccagcagcgccagaggccccaagcctccgccagcaccaggaccgc
agcccgaccccaaaacacccccggaacacccgcaggccgccccctgacgccgaggatcca
ggcaaggacccccagggccacacaccccgacagacaggcgacggaggatgggggaggagg
gggggagcatgtggagctaaagcatccaggcccatctcatacatacccaggaggatgcgg
accaggcacccccctccagaccgacagcagcgcaggggacatcaggaaaaaacgccacag
gtgctgtgcggagaactggcgcccccgaccgcagtcgcggcgccagcagcctga

DBGET integrated database retrieval system