KEGG   Nanorana parkeri: 108792234
Entry
108792234         CDS       T04897                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04060  Cytokine-cytokine receptor interaction
npr04068  FoxO signaling pathway
npr04144  Endocytosis
npr04218  Cellular senescence
npr04350  TGF-beta signaling pathway
npr04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108792234
   04350 TGF-beta signaling pathway
    108792234
   04068 FoxO signaling pathway
    108792234
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108792234
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108792234
  09143 Cell growth and death
   04218 Cellular senescence
    108792234
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108792234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108792234
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108792234
Protein kinases [BR:npr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   108792234
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 108792234
NCBI-ProteinID: XP_018418472
LinkDB
Position
Unknown
AA seq 825 aa
MKTCDNRELWRAGIPAEACSAAAAVDRIEFRVAMNAEDVFKRSRRLLCSQYLRPQPGHSV
YLPGHGGGYKRPRIFTSSLCGPVRHNIALASTASMPGSLSSAHGHFYGWSVLLAASTHQV
GYGPCKGMNRAMQRLWFTGPHSEDLRSGEEGPPGFVFQELKVTCAFCDVLPTTCTQNKGH
CNSSCDKFSFCEHADEVCVAIWRSNGSSVTEETLCHDPKLELYGHKLDDYNSSKCHMKKK
NHLGETMFMCTCNTDECNSKFIFEDATAKKHHTEPMSHKVIDESNNSKGKIPDWHSEPGG
KVAFKHLCRFCDSLPSTCLISDGNCKSTCDKTAFCEFYDEVCVAIWKHNDTHITEETLCH
SPKHELYGHMLDEYTEPSCTMKEKKMAGGTMFMCSCSEDECNEKFTIQGTSDLLFDTTQC
PDTTIVALASLLPPVAIAGAVIIIFYCYRVHRKNKLNKNWDSNQKCSKHRHMDCSIMLDD
DRSDISSTCANNLNHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSDQFETVAVKIFPYE
EYASWKMEKEIFSDINLKHENVLQFLTAEERKTDVGKQYWLITAFHSKGNLQEYLSRHII
CWEDLLLLGGSLARGVAHLHSDQTPCGRPKTPIVHRDLKSSNILVKNDLTCCLCDFGLSL
WLDPSLSVDDLANSGQVGTARYMAPEVLESRINLENMESFKQTDVYSMALVLWEITSRCN
AVGEVKDYEPPFGTKVREHPCVESMKDNVLRDRGRPEISNSWLNHQGIQLVCETITECWD
HDPEARLTAQCVDERFNELEHLDRISERSSSEEKIPEDCTENTNK
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgaaaacatgcgacaaccgagagctgtggagagctggcatccctgctgaagcatgtagt
gctgcagcagctgtggatcgaattgagtttcgggttgccatgaacgctgaagatgttttc
aaaaggagccgtaggctcctctgctctcagtaccttcgccctcaaccaggacattccgtg
tatcttcctggtcatggcggaggatacaagcggccacggatcttcacttcttcactatgt
ggccctgtcaggcacaacatagcccttgcaagcacagcatccatgccaggttctctttct
agcgcacatgggcacttctatggatggtctgtactcttggcagcatccacccatcaagtg
gggtatggaccatgcaaaggaatgaatagggcaatgcaaaggctatggttcactgggcca
cacagtgaagatctcaggagtggggaggaaggtccaccaggtttcgtattccaggagctc
aaagtaacatgtgcattttgtgatgtgcttccaacaacatgtacacaaaacaaaggtcac
tgtaacagttcctgtgataaattttcattttgtgaacatgcggatgaagtatgtgtagcc
atatggagaagcaatggttcttctgtcactgaggaaacactgtgtcatgaccccaaactg
gaactgtatggacacaagctggatgactataactcctcaaaatgtcacatgaaaaaaaag
aaccacttgggagagacgatgttcatgtgcacttgtaacactgatgagtgtaattctaag
tttatttttgaagacgcaacagcaaaaaaacatcatacagaacctatgagtcacaaagtc
atagatgaaagcaataattctaaaggcaagatacctgactggcacagtgaacctggagga
aaggtggcatttaagcatttgtgcaggttttgtgatagtctaccatcaacatgtttaata
agtgatgggaattgtaagagcacctgtgacaaaactgccttttgtgaattctatgatgaa
gtgtgtgtggcaatatggaaacataatgacactcatataactgaggaaacactgtgccat
agccccaaacatgaactttatggtcacatgcttgatgagtacaccgaaccatcttgtaca
atgaaagaaaaaaagatggctggcggtacaatgtttatgtgctcttgctctgaagatgag
tgcaacgaaaagtttacaatacaaggtacatctgacttactttttgatacaacccaatgc
ccggacacaaccattgttgcactagcaagtcttcttccaccagttgccattgcaggtgca
gtaatcatcattttttattgttaccgagttcatagaaaaaataagctgaacaagaactgg
gacagtaaccaaaaatgcagcaaacatcgacatatggactgttccattatgctagatgat
gaccgttcagatataagttcgacatgtgccaacaatctgaatcacaacactgaacttctt
cccattgaactggacactttggttggaaaaggacgatttgctgaagtttacaaagccaaa
ctcaaacaaaacacttcagaccagtttgaaacagtagctgtcaaaatttttccatatgaa
gaatatgcatcttggaaaatggagaaggaaattttttcagatattaatctaaaacatgaa
aatgttttacagtttttgactgctgaagagaggaaaacagatgttggaaagcaatactgg
ttaattacagcgttccactctaaaggcaatttacaggaatatttatcaagacacatcatt
tgttgggaagacctcttactgcttggtggctctttggctcgcggggttgcccacttacat
agtgaccagacaccatgtggaagaccaaagactccaatagtgcatcgagatttgaaaagc
tcaaatatactcgttaaaaatgacctcacttgttgtttatgcgactttggattatctctg
tggttggatccatctctttcagtggatgatcttgctaatagtggacaggttggaactgcc
agatatatggctccagaagtccttgaatccagaataaatttggaaaatatggaatcattt
aaacagacagatgtgtattccatggcacttgtgttatgggaaattacatcccgctgtaat
gcagttggagaagtaaaagattatgaacctccatttggcaccaaagtgcgagaacacccg
tgcgttgaaagtatgaaggataatgtcctgagagaccgaggtagacctgaaatttccaac
agctggttgaaccaccagggtatccagcttgtatgtgaaaccataacagaatgttgggac
catgacccagaggccaggctcaccgcccagtgcgtagacgagagatttaatgagttagaa
catctcgacagaatctctgagagaagcagctcggaggaaaaaataccagaagactgtacg
gaaaacacaaacaagtga

DBGET integrated database retrieval system