KEGG   Nanorana parkeri: 108792548Help
Entry
108792548         CDS       T04897                                 

Definition
(RefSeq) alkaline phosphatase, tissue-nonspecific isozyme-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
npr  Nanorana parkeri
Pathway
npr00730  Thiamine metabolism
npr00790  Folate biosynthesis
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    108792548
   00790 Folate biosynthesis
    108792548
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npr04147]
    108792548
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:npr00537]
    108792548
Enzymes [BR:npr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     108792548
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108792548
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:npr00537]
 Enzymes
  108792548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 108792548
NCBI-ProteinID: XP_018418849
LinkDB All DBs
Position
Unknown
AA seq 463 aa AA seqDB search
MAALNLNPNVNKAKNLIMFLGDGMGVATITAARIYQGQLAGQPGEENVLEMEKFPYVALS
KVYNVDAQVPDSAGTGTAYLCGVKANSGTLGVSAAVQSRVCTSANGNEVNSILHRAKLAG
KSVGIVTTTRVQHASPAAAYAHIVDRNWYSDNEMTVNMINSGCKDIAYQLVHNTDIDVIL
GGGRAYMNAKGTPDPEYPTSTSSQALRRDGLNLTNIWLNKRPGSKYVWNKQDFDAVDETT
TDYLIGLFEPKDLKYELNRNPSTDPSLEEMTEKAIKILSKNPNGFFLFVEGGRIDHGHHD
GNAKNSLTEAVEFDKAIRKAGQLTLESDTLTVVTADHSHVFTFGGYTDRGNSIFGLAPSR
ASDLKPFTSLLYGNGLGFKLTNGVREDITSIDTESSSYRQQAAVPLVSETHGGEDVAIMA
KGPFAHLFHGIHEQNYIAHVMAYAACLEPYTDCIQLKSASPHN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctgaatctgaatccaaatgtcaacaaagccaagaatctcattatgttcctc
ggagatggaatgggtgtggccacaattacggcagctcgtatttaccagggacagctggct
gggcaacctggagaagagaatgtcttggagatggaaaaattcccatatgtggctctttcc
aaggtgtacaatgtagatgcccaggttccagacagtgcaggcactggaaccgcctactta
tgtggagttaaagccaattctggaactttgggagtgagcgctgctgttcagagtagagtc
tgcactagtgctaatggaaatgaggtgaattctattcttcacagagctaaactagcaggt
aaatcagtgggtattgtgacaaccacacgtgtccaacatgcctctccagctgcggcctat
gctcacattgtcgataggaactggtactctgacaatgagatgaccgtgaatatgattaac
agtggctgcaaggatattgcgtaccagcttgtgcacaacaccgacattgatgtgattctg
ggaggtgggagagcctatatgaatgccaaagggacacctgacccagaatacccaaccagt
acatcaagtcaagcccttcgaagagatggccttaatttgactaatatttggttgaataaa
aggccggggtcaaaatatgtgtggaataaacaagactttgatgctgtggatgaaactaca
acagattatctcatagggctgtttgaaccaaaagacttgaaatatgaactaaatcgcaat
ccttccactgacccatccctagaggagatgactgagaaggccattaagatcctaagcaag
aatcccaatggatttttcctttttgtggaaggtggcagaattgaccatggtcatcatgat
ggcaatgctaagaattccttgacagaggctgttgagtttgataaagccattcgcaaagct
ggccagctgactttagaatctgacacattgactgttgtgactgctgaccattctcatgtc
ttcacctttggagggtacacagatcgtggtaacagtatttttggtttggcaccaagcaga
gccagtgacctcaaaccatttaccagcttgctgtatggaaatggtcttggattcaaactc
actaatggagtacgagaagatatcacttccattgatacagaatcctccagttacagacag
caagcggctgtcccacttgtttcagaaacacatggaggagaagatgtggccatcatggct
aaaggcccatttgctcatctgttccatggcatccacgagcagaattatattgcccacgtg
atggcatatgcagcctgtctggagccctatacagactgcatacagttaaagtctgcctct
ccccataactaa

DBGET integrated database retrieval system