KEGG   Nanorana parkeri: 108792573
Entry
108792573         CDS       T04897                                 

Gene name
CACNA1E
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108792573 (CACNA1E)
   04020 Calcium signaling pathway
    108792573 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:npr04040]
    108792573 (CACNA1E)
Ion channels [BR:npr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108792573 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 108792573
NCBI-ProteinID: XP_018418879
LinkDB
Position
Unknown
AA seq 2233 aa
MARFGEAVVGRLGSGDGGSERSKTLQGSPAAPLGTQAAFKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIIRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPGDDKTPM
SRRLEKTEPYFIGIFCFEAGIKVVALGLVFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHKACYRNQSGWDAMDPPLPCGVPRCPDGYECKEWIGPNDGITQFDNILFAVLT
VFQCITMEGWTTVLYNTNDALGPTWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERV
ENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSRTE
AMNRDTNEDHCVDISSVGTPLARASIKSNKMDGASYFRHKERLLRISVRHMIKSQVFYWL
VLGVVALNTACVAIVHHKQVHWLSHILYYAEFLFLGLFMVEMFFKMYGMGPRLYFHSSFN
CFDCGVTIGSIFEVIWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMNSMK
SIISLLFLLFLFIVVFALLGMQLYGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNE
VMYNGIRSQGGVRSGMWSSIYFIILTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEAEE
AFNQKHALQKAKEVSPMSAPNASSVENDRRKRHTMSIWEQRTSQLRRHIQMSSKEALQNE
ELAALNPHSSIYRKTKQAEESTAEKVEGPEEEKPGTDGPKDGEESPTHQNLREHWRQKSR
HVKAENTDPNGTTLEESVRRRQSQRRSRHRKVRTEGKETSSNPNSTSASQEGGLDRETTE
HGKTPKEEKMNGEAKEVRITEEEPPSSCLKYCEDRNDSTMGCEGPIPNTAPLQEMSHGKN
GSPPDMDYSEQALLGSMRSQEESPNPTSCSLADVSSSTERITESTVITLPDAGMASDCTV
VQMTEGRDGEISLVSQEQEKDEEEADDLEEQAMKRKGKVLESPKAIVPYSSMLIFTSANP
VRKVCHYIVNLRYFEMSILLVIAASSIALAAEDPVLTNSDHNKVLRYFDYVFTGVFTFEM
VIKMIDQGLILHDGSYFRDLWNILDFVVVVGALIAFALANILGTNKGRDIKTIKSLRVLR
VLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDS
SKDTEKECIGSYIDHEKNKMEVKRREWKRHDFHYDNIIWALLTLFTVSTGEGWPQVLQHS
VDVTEEDRGPSRGNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECRLEK
NERACIDFAISAKPLTRYMPQNRNTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYQ
APYTYELALKYLNIAFTMLFSLECILKIIAFGFLNYFRDTWNIFDFITVVGSITEIILTD
SKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIY
AIIGMQVFGNIQLEEDSHINRHNNFRSFSSSLMLLFRSATGEAWQEIMLSCLGDKGCEPD
TSAAAHNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLD
EFVRIWAEYDRAACGRIHYPEMYEMLTLMSPPLGLGKRCPNKVAYKRLVLMNMPVTEDMT
VHFTSTLMALIRTALDVKIAKGGADRQQLDSELQNEILAIWPNLSQKMLDLLVPMPKASD
LTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEASSLPEEILSNAKALPYLQ
QDTLSGLXVLAAFPSLSPMSPEEIFQPPCLDEDDEDFEEQLSLEPEVREYSKEQLPNQGS
YIPGEMLERPASVRASSMPRLAENPQVLSDVSSMRRSFSTTADKRMRSSWLDDFSLDRSG
MDSYKQQRRSYHASLRLSTHRMNSDTGRLDTHRSGGRERGRSKERKHLLSPDPSRCNSEE
RSPQAACEHHDHQLSPSHTHSSVQVRMLDSLNESCIPSDTSTPRRGRRQLPSVPATPRPL
ISFSSLIRRQKHSSPPMNDSDNAAPLPSDPGLSESSCSLQGRHSSQSTPQHYISEPYLAL
PEEMQSLDCPTEDTLTFEVAVATSLGRSNTIGSAPLRHGWQMPNGHYRRRRKGGVPPVIA
SRELSDTEEDDRC
NT seq 6702 nt   +upstreamnt  +downstreamnt
atggctcgttttggagaggcggtggttggccgattggggtccggggatggaggatcagag
aggagtaagactctgcaagggtccccggctgccccgctggggacccaggcagctttcaag
caatccaaagcccaaagagcaaggacgatggctttatacaaccccataccagtccggcag
aactgcttcaccgtgaacaggtcgctgttcatctttggagaagacaatatcatcaggaaa
tatgctaagaagcttatcgactggcctccttttgaatacatgatccttgctactatcatt
gcaaattgcattgttctggcattggagcagcaccttcctggagatgacaaaacgcccatg
tctcgtagattggagaagactgaaccctatttcatagggatattttgctttgaagctgga
attaaggttgttgccctaggactggtatttcacaaaggttcttacctccgcaatggctgg
aacgtcatggactttattgtagttcttagtggcattctagccacagccggaactcacttt
aatactcacgtggacctgcgaacattgcgggcagtgcgtgttctccgaccactcaagctg
gtctcgggaattccaagtttacagattgtcttgaaatccatcatgaaagcgatggtacct
ctgctacagattggattgctgcttttttttgccattctcatgtttgcaattattggactt
gagttttacagtggcaagctgcacaaagcctgttacaggaatcaatcaggatgggatgca
atggaccctcctctcccatgtggtgttcctagatgcccagatgggtatgagtgcaaggaa
tggattggacccaatgatggaattactcagttcgataacatcctatttgcggtgctgacc
gtcttccagtgtataaccatggagggctggaccacagtgctgtacaataccaatgatgcc
ttaggacccacttggaactggctgtatttcatccctctcattatcataggatctttcttc
gtgctcaacttagttcttggtgttctgtccggtgaatttgccaaagagagggagcgtgtg
gagaacaggagggccttcatgaagttgcgcaggcagcagcagattgaaagggaactgaat
ggctatcgagcatggatagataaagctgaggaagtgatgctggcagaagaaaataaaaat
tctgggacctcagctttagaagttctcagaagagcaacaattaaaaggagtagaacagaa
gccatgaaccgggacacgaatgaggaccactgtgtcgatatatcctctgtcggcactccc
cttgccagagccagtatcaagagcaacaaaatggatggtgcatcttattttcgccacaaa
gaaagattattacgtatatctgtacgacacatgatcaaatcccaggtcttttattggctg
gttttgggagtagtagcattaaacactgcctgtgtggccattgttcatcataaacaggtt
cactggctctcacatatcctgtactatgcagaatttttgtttcttgggttatttatggtg
gagatgtttttcaagatgtatgggatgggtccaagactctactttcactcctccttcaac
tgttttgactgtggggtgacaattggaagtatatttgaagtcatttgggctatatttaga
cctgggacatcttttggaattagcgtccttagagcactgcgtcttctaagaatttttaaa
ataacaaaatactgggcctcactgaggaaccttgtcgtatccttgatgaattccatgaag
tcaattatcagtctgctgttccttctttttctctttattgttgtgtttgctcttctggga
atgcagctctatggtggcagatttaattttaatgatggcacgccttctgcaaattttgac
acctttccagcagcgatcatgacagtttttcagatcctaacaggagaggattggaacgag
gtgatgtacaatggaatccgctcacagggtggagttcgttctgggatgtggtcgtccatt
tatttcatcattctcaccctgtttggcaactacactctcctgaatgtatttcttgccatt
gctgtggacaatctggccaatgctcaggagctaactaaggatgaacaggaagcagaggaa
gcatttaaccagaagcatgcccttcaaaaagccaaggaggtcagccctatgtctgcacct
aatgcatcatctgttgagaatgatcgccgaaagcggcataccatgtccatctgggagcag
cgcacaagtcaactaaggagacatatacagatgtctagtaaggaagctctacagaatgaa
gaactagcagctctgaatcctcactcaagtatatatcgcaagacaaagcaagcagaagag
tcaactgctgaaaaagtagaaggaccggaagaagaaaagccgggaacagatggtccaaag
gatggagaagaaagccccactcatcaaaacctcagggaacactggcggcagaagtctaga
catgtcaaagctgaaaatacagaccccaatggcacaacacttgaggagtctgtacgcagg
aggcaaagccaaagacgaagtcggcacagaaaagttaggactgaagggaaagagacatcc
agcaatccaaatagcacctcagccagtcaggaaggaggacttgacagagagaccactgag
catggtaaaacacccaaagaggagaaaatgaatggtgaagccaaggaagtgaggataact
gaggaggagccaccttcgagttgtctcaaatactgtgaagataggaatgacagcacaatg
ggatgtgagggtcccattcccaacactgctcccttgcaggaaatgagccatgggaagaat
ggcagtcccccagacatggattacagtgagcaggccttgctgggcagcatgaggagtcaa
gaggaaagtcctaatccaaccagttgcagtttggctgatgtctccagcagcacagagcga
atcacagagagtacagtgatcaccttacctgatgctggaatggcttccgactgcaccgtg
gtacagatgactgaaggaagagatggagagatcagtcttgtatctcaggagcaagagaag
gatgaggaagaggctgacgatttagaagagcaagctatgaaaaggaaaggaaaagtgcta
gagtctccaaaagctattgtgccatacagttcaatgcttatcttcacttctgccaatccg
gtaaggaaagtgtgccattacattgtgaatctacgatattttgaaatgagcatccttcta
gtgattgctgctagtagtatcgccctagcagctgaggacccagtgttgaccaactctgac
cacaacaaagttcttcgctactttgactatgttttcactggtgttttcacctttgagatg
gtaataaagatgatcgaccagggtttaatcttacatgacggttcatacttccgtgaccta
tggaatatcttggattttgtagttgtggtgggcgctttaatagcttttgctttggcgaat
attttggggactaacaaaggccgagacatcaaaaccattaagtctctacgtgtgctgagg
gtgcttcgtccgctgaaaaccatcaaacgtctccccaagctgaaggcagtatttgattgt
gtggttaactctttgaagaatgtctttaatatcctcatcgtgtacaaactcttcatgttt
atattcgccgtcatcgctgttcagctcttcaagggcaagttcttttactgcacagacagc
tcaaaggatacagagaaggaatgcataggaagttacatagatcatgagaagaacaagatg
gaggtcaaacgcagagagtggaagaggcatgatttccattatgacaacataatttgggct
ctccttactctcttcactgtatctacaggggaaggctggcctcaggttttacagcattcg
gtggatgtgactgaagaggaccgtggtcccagtcgtggcaaccgtatggagatgtcaatc
ttctatgttgtctattttgttgtcttccccttctttttcgtcaatatctttgtggctctg
attatcatcactttccaagaacaaggggacaagatgatggaagaatgccggctggaaaag
aatgagagagcctgcatagactttgcgattagtgccaaaccactcactcggtatatgccc
cagaatcgcaataccttccagtatcgcgtctggcactttgtagtttcaccatcatttgaa
tacaccatcatggctatgattgctctaaatactgtggtgctaatgatgaagtattatcaa
gcaccatacacttatgagcttgctttaaaatatttgaacatcgccttcaccatgttattc
tccctggagtgcatcctcaagatcattgcatttggattcttgaactattttagggatacc
tggaacatttttgattttattacagtagttggtagcatcacagagataatacttacagac
agtaagctggtgaacacaagcagtttcaacatgagcttcttgaaattgtttcgagctgcc
cgactcattaaacttcttcggcagggatacacaatccgcattttactatggacttttgtc
cagtcctttaaggctctcccttatgtctgcctcctgattgctatgttattcttcatctat
gccattataggcatgcaggtatttggtaacatccaattggaagaggacagccatattaat
agacacaacaacttcaggagtttctccagttccctcatgctgctgttcaggagtgccact
ggtgaggcctggcaggagatcatgctgtcatgcctgggagataaaggttgtgaacccgac
actagtgctgctgcgcataacgagaacgagcgttgtggaactgatctggcttacgtgtat
tttgtctcctttattttcttctgttcttttctgatgttaaatctttttgttgctgtcatc
atggataactttgaatacctgaccagagactcttctattctcggcccccaccatctggac
gagtttgttcgaatctgggcggaatacgacagagcagcatgtggccgcatccattatcca
gagatgtacgaaatgctgaccctcatgtcaccacctttaggcctcggaaagagatgtcct
aacaaagtggcttataagagactggtcctgatgaatatgcccgtaacagaagatatgacg
gttcatttcacttccactctaatggctcttatccggacagcactggatgtgaaaattgcc
aaagggggagctgacagacaacagctggattcagagctgcagaacgaaatactggccatt
tggccaaatctttcccaaaagatgctagacctacttgttccaatgccaaaagcctctgat
ttgaccgtgggcaagatttatgctgctatgatgatcatggactattataagcagagtaaa
gcaaaaaagcagaggcagcagctggaagaacagaaaaatgcaccaatgtttcaaagaatg
gaagcctcatctttacctgaggagatattatccaatgccaaagccttaccatacctccag
caggatacactgtcaggactgtgagttctggctgcttttccctcactgagcccgatgtcc
cctgaggagatatttcaacctccgtgtctggacgaggatgatgaagactttgaagaacag
ctgtctctggagccagaggttagagagtatagcaaggagcagcttcctaatcaaggcagc
tacatacccggggagatgctggaacgtccagcgtcagtgagagcttcttccatgccacgc
ctggcggagaacccccaggtcctgtctgatgtgagctccatgcggcgctctttctccacc
actgcggataagcgaatgcgcagttcctggctggatgatttctcattagatagaagtggt
atggatagctacaagcagcaacggcgcagctatcatgcttctctaagactatccacccac
cgaatgaattctgatacaggtcgcctagatactcatcgttcaggaggaagagaacgaggt
cgttctaaggagaggaaacatcttttatctcctgatccttcccgttgcaactctgaagag
aggagtccgcaagctgcttgtgagcaccatgatcaccagctgtcacccagccacacgcac
agcagcgtgcaggtaaggatgcttgactctttaaatgaaagctgtattccttctgacacc
agcacaccaagacgtggtcggcgccagcttccttctgtgcctgcaaccccaagacctctt
atctctttctcttctttaattcgccgtcaaaaacacagttccccacctatgaatgacagc
gataatgcagcacctcttccaagtgacccaggtctgagtgagtcttcctgttctctccag
ggacgtcacagctcccagtccacccctcagcactatatctcagagccatatttggcccta
cctgaggagatgcaaagcttagactgccccactgaggacacacttacttttgaggttgct
gtggctaccagcctaggccgctctaacacaattggctctgcccctttacgtcacgggtgg
cagatgcccaatggtcactatcggcgtagaagaaagggtggtgtgccacctgtcatagct
tcccgtgaattgagtgacacagaagaggatgatcggtgttaa

DBGET integrated database retrieval system