KEGG   Nanorana parkeri: 108792966Help
Entry
108792966         CDS       T04897                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
npr  Nanorana parkeri
Pathway
npr00052  Galactose metabolism
npr00500  Starch and sucrose metabolism
npr01100  Metabolic pathways
npr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108792966
   00500 Starch and sucrose metabolism
    108792966
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108792966
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npr04147]
    108792966
Enzymes [BR:npr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108792966
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108792966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 108792966
NCBI-ProteinID: XP_018419363
LinkDB All DBs
Position
Unknown
AA seq 892 aa AA seqDB search
MFRQTTMDRRKLTLITCLLFMTCTACFTAPSYVEGPQPSQCSVAPCSRFDCAPDKGVSKE
ECEARGCCYSPTSEQLGIGQPWCFFASNYPSYKVTNKSETENGFTATLTRSIKTFMPDDI
NELLLDILLETDSRLHFTIKDPTKKRYEVPMHTPKAKGKAFAVQYDVQITDDPFSLVVRR
KSNGQIVMNTALAPLFFADQFLQISTSLPSQYLYGLGEHLTSLNLDTAWSRLTFWNRDIS
PQKDTNLYGSHPFYLALEKDGSAHGVFLLNSNAMDVLLQPAPALTWRTTGGILDFYIFLG
PDPKAVIRQYQEVIGLPFMPPFWGLGFHICRWGYSTTDMTREVVKNMTKANMPLDVQWND
IDYMDANRDFTYDQTRFKDYANMVKEFHEQGRKYIMIVDPAISSSSPPGSYPPYDDGLKR
RVFITNGTGQPLVGKVWPGLTVFPDFTNPETFSWWYDMAKDFHDKVPFDGMWIDMNEPSN
FVTGSLDGCPDNKLENPPYIPAVKGGTLQHATICTSSQQNISSHYNLHNLYGLSEAIASY
HALVKIRGKRPFIISRSTFSSHGHYAGHWTGDIFSSWEQLYYTVPAILLFNMYGVPLVGA
DICGFGGDTTEELCVRWSQLGAFYPFMRNHNSHDSRPQEPYVFSEKSQTAIRNALYIRYS
LLPYLYTLFHRAHSSGDTVARALFIEFPTDPNTWTIDRQFLWGEALLITPVLEQGKTEVN
GYFPSGTWYSLLTGVQLQSKGQWITLTAPMDTINVHVRGGCILPLQLPGMTTQETRKNSL
VLVVALTTEGFARGDLFWDDGDSLGTFERRDFTQVLFIATHNTLLSEVIQLNSDADGLKL
ESVKIYGIASPPKKVLVNQVATEDFTYRKDTKVFSVEKLSLSIENQFTITWS
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggcaaacgacaatggatagaaggaaactaacattgattacctgtctgctcttt
atgacatgtacagcatgctttacagcaccctcatatgtggaaggtcctcagccttcccag
tgctctgtggctccctgcagccggtttgactgtgcacctgataaaggtgtaagtaaggag
gagtgtgaggctcgggggtgctgctattctccaacatctgaacaattgggaataggacag
ccctggtgtttctttgcctccaactatccaagttacaaagtgaccaacaaatctgaaaca
gaaaatggatttactgctacactcacacgttccatcaaaacatttatgccggatgatatt
aatgagttgctgcttgatattttacttgaaactgacagcagactacattttacaattaag
gacccaacaaaaaagcgttatgaggtgcccatgcacacccctaaagccaaaggaaaggca
tttgcagtccagtatgatgttcagattactgatgaccccttcagccttgtggtcagaaga
aagtccaatggacagatcgtgatgaacactgccttggctccattgttctttgcagaccag
ttcctacagatttccacatccctgccttctcaatacttatatggtttgggagaacatctc
acttcccttaacttagacaccgcctggtcccgtctgacattttggaacagagatatttca
ccgcagaaagatacaaatctctatggctctcatccattctacctggccctggaaaaagat
ggttctgctcatggggtttttctacttaacagcaatgccatggatgttctgttgcagcca
gctccagccttgacttggcgaaccacaggaggaatcttggacttttatatcttcttgggc
cccgaccccaaggctgtcatacgacagtatcaagaagtgattggacttcccttcatgcca
cctttttggggacttggattccatatctgtcgctggggatattcaactactgatatgact
cgggaggtggtgaaaaatatgaccaaagccaatatgcctttggatgtacaatggaatgac
attgattacatggatgcaaaccgagacttcacatatgatcagacacggtttaaggactat
gcgaatatggttaaagaattccatgaacaaggtcgtaaatacatcatgattgtggaccca
gctatcagcagttcaagcccccctggaagttatccaccttatgatgatggactgaagaga
agggtgttcatcactaatgggactggccaacctcttgtaggcaaggtatggccgggtctt
acggtgtttcctgatttcacaaaccctgaaactttcagctggtggtatgacatggcaaaa
gattttcacgacaaggttccttttgatggcatgtggatagacatgaatgaaccatctaac
tttgtcactggctcgttggatggctgtccagacaataaacttgaaaaccctccgtacatt
cctgctgtcaaaggcggtaccctacaacacgctaccatttgtacatccagtcagcagaac
atctcttctcactacaaccttcataacttgtacggtctctctgaagcaatcgcatcatac
catgctttagtgaagatccgtgggaaacgccctttcatcatctctcggtccacgttttct
agccatgggcactatgcaggtcattggacaggagatatattcagcagctgggaacagtta
tattacacagtaccagccatattactcttcaatatgtacggagtccctctggtcggagca
gacatttgcggctttggtggagatactactgaggagctttgtgtgcgatggagtcagctg
ggtgctttctatccattcatgagaaatcataacagtcatgattctcggccacaggaacca
tatgttttcagtgagaaatctcagaccgctatacgaaatgctttgtacatccggtattcc
ctgcttccctatctgtacacgttgtttcatagagctcacagctctggggacactgtagct
cgtgcgctcttcatagagttccccactgacccaaacacatggactatcgaccgccagttc
ctttggggagaggcactgctgattacgccagtccttgagcaggggaaaactgaagtgaat
ggatactttccctctgggacatggtattcacttctgacgggtgtacaacttcaaagtaaa
ggtcagtggatcacacttactgcaccaatggacacaatcaatgttcatgttagaggtggc
tgcattttgcctttacagttaccaggtatgaccacacaggagacacgcaagaatagtctg
gtgctggtggtggcacttactacggagggatttgcacgaggggacctgttctgggatgat
ggagacagtttaggaacgtttgaaaggagagattttacccaagtgctatttattgcaaca
cataacactcttctaagtgaagtgatacagctcaacagtgatgcagatggcttgaaatta
gaatcagtgaagatatatgggattgcgagtcctccaaagaaagtgctggttaatcaggtt
gctactgaagatttcacctacagaaaagacaccaaggttttctcggtggagaagctctca
ctatcaatagaaaaccagtttacaatcacatggtcttga

DBGET integrated database retrieval system