KEGG   Nanorana parkeri: 108792971Help
Entry
108792971         CDS       T04897                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
npr  Nanorana parkeri
Pathway
npr00052  Galactose metabolism
npr00500  Starch and sucrose metabolism
npr01100  Metabolic pathways
npr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108792971
   00500 Starch and sucrose metabolism
    108792971
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108792971
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npr04147]
    108792971
Enzymes [BR:npr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108792971
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108792971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 108792971
NCBI-ProteinID: XP_018419368
LinkDB All DBs
Position
Unknown
AA seq 883 aa AA seqDB search
MAWTFCIFLMIWTVCRGENASKCSAAPNNRFDCAPEKILNEEECEARGCCYISDDSLGTG
QPACFFPPDYPNYKMTDFTETNYGYTAILSRMKHTFMPNDLMKLRMDVFFETQYRLRIII
KDAIQKRYEVPIETPQVTEKADPVQYDVQFTNESFGFRVSRKCNGNVLVDTNIAPFIFAD
QFIQMSTSLSSSYVYGLGEHLTSINLDLEWKKLTFWNRDLIPRKDANLYGSHPFYLSFEK
GGSAYGVFLLNSNAMDIILQPAPALTWRTIGGIVDMYLFMGPDPKTVIKQYQEVIGFPFM
PPYWAFGFHLCRWGYNSSAMTREAVEKTRAAGIPLEVQWNDIDYMDAYRDFTYDPDHFGD
LPEMVNDLHDMGMKYVAIMEPAIGNSSPPGSYPPYEDGLQRGIYVTNETGQPLVGKVWPG
NTVFVDFTNPEAHKWWHDMFKAFHDKVPFDGAWIDMNEPANNVHGSLNGCPDNSIENPPY
VPDVVGKVLRDTTICASSYQNISSHYNLHNMYGLFEAIATHDALVKIRNKRPFVISRSNF
PTLGRYAGHWTGDLESTWEQLYYTIPAIVLCNMYGIPLVGADLCGFVGDASEELCVRWSQ
VGAFYPFMRNHNTKDAKSQEPYVFSKKAVDAIRKATLARYMLLPYMYTLFYKSHMSGETV
VRAPFMEFPHDQNTWTIDHQFMWGEALLITPVVEQGKTVVTGYFPAGMWYSPVRGTGFES
KGEWKTFPAPLDTIHYHIRGGYIIPAQEPAMTTTEMRRNGLILMVALTKDGAARGELYWD
DGDSLDTYERGDYSLITFSAQDNTLASKVVKLEKEAESLKLKVVGLFGIANIPKEILING
APALDYQYLQNEQYLKIQQLDLPLGREFEIQWSFSSSSVKVDL
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggcatggacattttgtatattcttaatgatttggacagtatgtagaggagaaaatgct
tcaaagtgttctgcagctcccaacaaccgctttgactgtgcaccagaaaagatcttaaac
gaggaagaatgtgaagctcgtgggtgctgttatatttccgatgatagtttgggaactggt
cagcctgcttgctttttcccaccagactatccaaactacaagatgactgacttcactgaa
acaaactatggatacactgccatcctcagtcgcatgaaacatacatttatgcctaatgat
ctgatgaaactgcgcatggatgttttttttgagacacagtacagattgcgtattattata
aaagacgcaattcagaagagatatgaagttcctatagagacaccacaggtcacagaaaaa
gcagaccctgtccagtatgatgtacaattcactaatgaatccttcggcttcagagtcagc
aggaaatgcaatgggaatgttttggtggacaccaatattgccccatttatctttgctgat
caattcatacaaatgtctacatctctttcatcttcctacgtatatggccttggggaacat
ctcacttctatcaacttagacctcgagtggaaaaaactcacattttggaacagagacctg
attccacggaaagatgctaatctatatggttcacacccattttatctaagttttgaaaag
ggtggttctgcttatggagtattcctgctcaacagcaatgccatggatatcatactgcag
ccagctcctgctttgacctggaggaccattggaggcattgtggatatgtatttgtttatg
ggccctgacccaaaaactgttattaagcagtatcaggaagtcattgggtttcccttcatg
ccaccatactgggcctttggcttccacttatgccgctgggggtacaattcatctgctatg
actcgggaagcagtggaaaaaacaagggctgctggtatacctctagaagtgcagtggaat
gatattgactacatggatgcataccgagatttcacatatgacccggaccattttggagat
ttgccagagatggtgaatgatttgcatgacatgggcatgaaatatgtggcgataatggaa
ccagccattggcaatagtagtcctcctggaagctatccaccctatgaagatggattacag
agaggcatttatgttaccaatgaaaccggacagcctcttgtgggcaaggtctggcctggc
aatactgtgtttgttgatttcacaaaccctgaagctcacaaatggtggcacgacatgttc
aaggcctttcatgacaaagtaccttttgatggggcttggattgacatgaatgagccggct
aataatgttcatggctccttgaatggatgtccagacaacagtattgaaaacccaccatat
gtgcctgatgttgttgggaaagtattacgtgataccaccatctgtgcctccagctaccag
aacatctcatcacactacaatcttcataatatgtatggactttttgaagcaatagcaact
catgatgcattagtgaaaatccgtaacaaacgtccttttgtgatctctcgatccaatttc
cccactcttgggcgctatgctggacactggacaggagacttagaaagcacctgggagcag
ctttactatacaatacctgctatcgtactgtgtaatatgtacggaatcccactagtgggg
gcagatctctgtggatttgtaggggatgcctcggaggagctatgtgtacgctggagccag
gttggggccttttatccattcatgagaaatcacaacactaaagatgcaaagtcacaggag
ccatatgttttcagcaaaaaagctgtggatgccatacgaaaagctacactagcaagatat
atgctgcttccctatatgtacacattgttttataaatcccacatgtctggtgaaactgtg
gttcgagccccttttatggagtttcctcatgaccaaaatacatggacaattgaccaccag
ttcatgtggggagaagctcttctaatcaccccagttgtggagcagggaaaaaccgtagta
acaggatattttcctgctggaatgtggtacagtccagtccggggtacaggattcgaaagt
aaaggtgaatggaaaacctttccagctcctttggacactattcattatcacattagaggt
ggctatatcatacctgctcaggaaccagctatgactacaacagagatgcgcagaaatggt
ttgatactgatggtagcacttacaaaggatggagcagctcgtggagaactatattgggat
gatggagatagcctggacacatatgagaggggagactacagcctgattacattttcagct
caagataatacccttgccagtaaagtggtgaaattagaaaaagaagcagagagcctgaag
cttaaagtagtgggactgtttggaatagcaaatattcctaaagaaatcctgattaatggt
gcccccgctctagattaccagtatttacaaaatgaacagtacctaaaaatacaacaactt
gatctgccacttgggagagaatttgaaatccaatggtctttttcttcctcttcagtgaag
gttgatctttag

DBGET integrated database retrieval system