KEGG   Nanorana parkeri: 108792989
Entry
108792989         CDS       T04897                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
npr  Nanorana parkeri
Pathway
npr04068  FoxO signaling pathway
npr04217  Necroptosis
npr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108792989 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108792989 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108792989 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:npr03000]
    108792989 (STAT3)
Transcription factors [BR:npr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    108792989 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N DUF4795 Tropomyosin_1
Other DBs
NCBI-GeneID: 108792989
NCBI-ProteinID: XP_018419389
LinkDB
Position
Unknown
AA seq 769 aa
MTQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWGFAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEEGRLLQTAA
AAAQQGGPASHPTVTVVTEKQQMLEQHLQDVRKKVQDLEQKMKVVENLQDDFDFNYKTLK
SQSDLSDLNGNNQAVTRQKMQQLEQMLTALDQLRRTIISDLAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIIQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYVMGFISKERERAILSP
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLHPDIPKEEAFSKYCRPESQEHPEPTDSGSTAPYLKTRFICVTPTTCS
NTLDLPMSPRTLDSLMQFPGEGADGSSGTPFDSVTFDMDLASECASSPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgacacaatggaaccagttgcagcagctggacaccagatacctggaacaacttcaccag
ctatacagcgacagctttcccatggagctacgccagttccttgcaccatggatagagagc
caggactggggttttgctgccagcaaggagtcgcatgcaactctagttttccacaatctt
ctgggtgaaatagaccagcaatacagcagattcctacaggaatccaatgtcctttaccag
cacaacctcaggagaataaagcaattcctacagagtaggtacctggaaaaaccaatggag
attgcacgtatagtagcccgatgcctgtgggaagaggggagacttcttcagactgcagca
gctgctgcccagcaaggaggccctgcatcccatcccacggtaactgtagttactgaaaag
caacagatgttggagcagcacctgcaggatgtcaggaagaaagtccaggacctcgaacag
aaaatgaaagtggtagaaaatcttcaagatgactttgacttcaactacaaaactttaaaa
agccaaagtgatctttcagatctaaatggtaacaaccaagcagtgactcggcagaagatg
cagcagttggaacagatgttgactgctctagaccaactaagaagaacaataattagtgac
ttggctggactcctgtctgctatggaatacgtccagaagactttaacagatgaggagctt
gcagactggaagaggagacaacagattgcatgcattggaggtcctccaaatatctgcctt
gaccgccttgagaactggataacctctcttgctgaatctcaactgcagacacgtcagcag
atcaaaaaactagaggaattgcagcaaaaggtctcttacaagggggaccccatcattcag
caccggcccatgctggaggagagaattgtggagttatttaggaatctcatgaagagtgca
tttgtggtggagagacagccatgtatgccaatgcacccagatcgccccctagtgatcaag
acaggagtacagtttactaccaaagtcagacttctggtcaagtttcctgagctcaattac
caactgaaaatcaaagtctgcattgataaagattctggggatgttgctgcgctcagaggg
tcacgcaaatttaatattcttggtacaaacacaaaggtgatgaatatggaggagtcaaat
aatggcagcctgtccgctgaattcaaacatttgactctcagggagcagagatgtggcaat
ggaggaagagcaaactgtgatgcatcacttattgttactgaagagcttcacctaattact
tttgagactgaagtataccaccaaggcttgaaaattgatctggagactcactcattacca
gttgtagtgatatctaacatttgtcagatgcccaatgcttgggcctccatactgtggtac
aacatgctgacaaacaacccaaagaatgtcaactttttcaccaagcctcccattggcaca
tgggatcaggtggctgaggttctaagctggcagttctcttccaccacaaaacgcggcctc
agcattgaacaattaaccacgctggctgaaaaactgctgggtcctggagtaaactattcc
ggctgtcaaatcacctgggccaaattttgcaaagaaaacatggctggaaaagggttttca
ttctgggtgtggctggacaatatcattgaccttgtaaagaaatacattctcgcactttgg
aatgaagggtatgtaatgggtttcatcagcaaagagcgtgaacgagccattctcagcccc
aaaccccctggtacattcctgctgaggttcagcgagagcagcaaagagggtggtattacc
ttcacctgggtggagaaagatatcagcggtaagacacagatccagtcggtagagccgtat
acaaagcagcagctgaacaacatgtcctttgctgaaatcatcatgggttacaaaattatg
gatgccaccaacattttggtgtcccctttggtgtacctgcatccggacatccccaaagaa
gaagccttcagcaagtactgccgcccagagagccaggaacatcccgaacccactgactca
ggtagcactgccccatatctgaagacgaggtttatttgtgtaacaccgacaacatgtagc
aacacattagacttgcccatgtctcctcgcaccttggactctctgatgcaatttcctgga
gaaggagctgatggcagttctgggaccccttttgatagcgtcacgtttgacatggacctg
gcttctgaatgcgcatcttcccccatgtga

DBGET integrated database retrieval system