KEGG   Nanorana parkeri: 108793029Help
Entry
108793029         CDS       T04897                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04012  ErbB signaling pathway
npr04068  FoxO signaling pathway
npr04150  mTOR signaling pathway
npr04270  Vascular smooth muscle contraction
npr04510  Focal adhesion
npr04810  Regulation of actin cytoskeleton
npr04910  Insulin signaling pathway
npr04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108793029 (BRAF)
   04012 ErbB signaling pathway
    108793029 (BRAF)
   04068 FoxO signaling pathway
    108793029 (BRAF)
   04150 mTOR signaling pathway
    108793029 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108793029 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108793029 (BRAF)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108793029 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    108793029 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108793029 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108793029 (BRAF)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108793029 (BRAF)
Protein kinases [BR:npr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   108793029 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 APH Kdo
Motif
Other DBs
NCBI-GeneID: 108793029
NCBI-ProteinID: XP_018419434
LinkDB All DBs
Position
Unknown
AA seq 837 aa AA seqDB search
MAALSGGSAEGPSLLNGDLESEAGGLSGAGEMSASGGYQEEIWNIKQMIKLTQEHIEALL
DKFGGEHNPPSIYVEAYEEYTSKLDALQQREQQLLECLGNGTDSSSSLSSEMTLSSVPSS
LSLAPSSLSVLQNPSDLSRINPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMM
RGLIPECCAVYRDQDGEMKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAF
CDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDRLDLLFVSKFFEHHPISQDEGPF
EEVTAAVESCSPSPLPDFSGSPNLQSSSPSKSIPIPQPFRPGDEDHRNQFGQRDRSSSAP
NVHINTIEPVNIDDLIRDQGLQRSEGAPQVQPTRCLRKYHNRNPSPLLHTLPSEIVFDFE
SDRVYRGSTPGLSATPPASLPGSLTNVKALQKSPGQQRERKSSSSSTEDRSRVKTLGRRD
SSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVL
RKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMD
YLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVI
RMQDKNPYSFQSDVYAFGIVQYELMTGQLPYQNINNRDQIIFMVGRGYLSPDFSKVRSNC
PKAMKRLMADCLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSL
YSLLAGVCKCLCDAPLYTPRINSCTVCLCKYSGNYLYIHFWNAGCLHFYCVLDLSGV
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctaagcgggggatcggccgaggggccctcactgctcaacggggacctggag
tccgaggccgggggcctgagcggagccggggagatgtcagcgtctgggggctaccaggag
gagatctggaacatcaagcagatgattaagttaacgcaagagcacattgaagccctctta
gataaattcggaggcgagcacaatcccccctcaatatatgtggaggcatatgaggaatac
acaagtaaactggatgccctccagcagagggaacagcagttactggagtgtttggggaat
ggaacagactcctcatcatccctgtcctcagaaatgactctatcttctgtaccctcctcc
ctgtctttagcgccctcttccttgtccgtcctgcagaacccctctgacctctcccgtatt
aaccccaaatctccacagaaacctattgtaagagtcttcctacctaacaaacagcgcaca
gtggtaccagctaggtgtggtgtgacagtgcgagacagcctaaagaaagcactaatgatg
cgaggtcttattccagaatgctgtgcggtctacagggaccaggatggggagatgaagcca
ataggctgggatacagacatcagctggcttacgggagaggagctacacgtagaagttctg
gagaacgtacccctcacaacacataattttgtacgtaaaacgttcttcacattggcattc
tgtgacttttgccggaagctgctattccagggttttcgctgccagacttgtggctataaa
tttcaccagcggtgcagcacagaggtgccccttatgtgcgtcaactacgacagacttgat
ttgttgtttgtctccaagttctttgaacaccacccgatatctcaggacgaaggtccgttt
gaagaggtgactgcagctgtcgaatcctgttccccctcacctctgcccgacttcagtggg
tctccaaacctccaaagtagttctccgtccaaatccatccccattccccagccttttcga
cctggcgacgaagaccatagaaaccagttcggccagcgagaccgttcgtcgtctgcccca
aatgttcatataaacaccattgagccagtaaacattgacgacttaattcgggaccagggc
cttcagcgaagtgaaggagcccctcaggttcagccgacccgctgccttcggaaataccac
aatcggaaccccagcccactcctccatacactccccagtgaaatagtctttgattttgaa
tctgaccgggtttacagaggttccaccccagggttatcagcgacccctccagcttccctc
cctggatccctcaccaatgtgaaggctctccagaaatccccagggcaacagagagagcgc
aaatcttcctcgtcctccacagaagacaggagtcgggtgaaaacacttgggcgtcgagat
tcgagtgacgactgggaaattccagatgggcaaatcacggttggacagagaataggatct
gggtcctttgggacagtatataagggaaagtggcatggagatgtagctgtgaaaatgttg
aatgtaactgcaccaactcctcagcaactacaagcctttaaaaatgaagtaggcgtgctc
aggaaaactcgacatgtgaatatcctgcttttcatgggctattctaccaaaccccagctg
gcaatagtgacccagtggtgtgagggttccagcctctaccaccatctacacatcatagag
accaaatttgagatgatcaagcttattgacattgcacgacagacagcacaaggcatggac
tatttgcacgccaagtcaatcatccaccgagatctgaaaagcaataatatttttcttcat
gaagacctcacggtaaagattggtgacttcggtcttgccacagtgaaatcgcggtggagt
ggctcacaccagtttgagcaattatcaggttccattctatggatggctccagaggtcatc
agaatgcaggacaaaaatccttacagctttcagtcagatgtctacgcgttcgggattgta
caatatgaattaatgactgggcagctaccatatcagaatattaacaacagagaccagatc
atatttatggttggccgaggttatctttctccggactttagcaaagttcgaagcaactgt
cccaaagcgatgaagaggttaatggcggactgtctgaagaaaaagagggatgagcggccc
ctatttccacagattcttgcctccattgaactcctggcccggtcattgccaaaaattcac
cgcagtgcatctgagccatcgttaaatcgagccggcttccagacagaagacttcagtctg
tattccctgctggcaggagtctgtaaatgtctgtgtgatgctccattgtacacaccacgc
atcaatagctgtacagtctgtctttgtaaatattctggtaattatttgtatatacacttc
tggaatgctggctgccttcatttttattgtgttttagatttatcaggtgtctaa

DBGET integrated database retrieval system