KEGG   Nanorana parkeri: 108793412Help
Entry
108793412         CDS       T04897                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
npr  Nanorana parkeri
Pathway
npr04068  FoxO signaling pathway
npr04110  Cell cycle
npr04115  p53 signaling pathway
npr04218  Cellular senescence
npr04310  Wnt signaling pathway
npr04340  Hedgehog signaling pathway
npr04371  Apelin signaling pathway
npr04510  Focal adhesion
npr04530  Tight junction
npr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108793412
   04340 Hedgehog signaling pathway
    108793412
   04371 Apelin signaling pathway
    108793412
   04068 FoxO signaling pathway
    108793412
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108793412
   04115 p53 signaling pathway
    108793412
   04218 Cellular senescence
    108793412
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108793412
   04530 Tight junction
    108793412
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108793412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Motif
Other DBs
NCBI-GeneID: 108793412
NCBI-ProteinID: XP_018419860
LinkDB All DBs
Position
Unknown
AA seq 290 aa AA seqDB search
MESSLLCWETEKELRAQVDPVLLQSRVLERLLTDQERYTPSPTYFQCVQREMHPYMRKML
TSWMLEVCEDQRCGEEVFPLAVNCLDRFLSLVPVEKRRLQLLGATCLLLCSKLKESQVIT
IESLCMYSDYSFTDTELRSMELLVLNKLKWDIEAVTPRDFLPYFLALLRLPAERLQQVRR
HSETFIALCTTDCTFIALPPSLVAAASLAAAVNGLGPENLGISYSSLATTNYLAQAIRCD
PNILRMCQEQIEASLQSNLQEAERNQVPVSKAVEEIERASTPTDVLDFDL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggagagcagtttgctgtgctgggaaactgagaaagagctcagagcacaggttgatcct
gtccttttgcagagcagggttttggaaaggctgcttacagatcaagagagatacactcca
tctccaacatacttccagtgtgtgcagagagagatgcacccctacatgaggaaaatgctg
accagctggatgttagaggtgtgtgaagatcaaaggtgtggagaagaggtgttccccctg
gctgtaaattgcttggaccgtttcttgtctctggtacctgtagaaaaaagacgacttcaa
ctcctgggggcgacttgtcttctgctttgttcaaaactgaaggagtcccaagttataacc
atcgagagcctgtgcatgtattccgactactccttcactgatacagagctgcggtcaatg
gaactactggtcctgaacaagctgaagtgggacatagaagcagtgacaccaagagacttt
cttccatatttcctggcactgctgaggcttccagcagagagactacagcaagtcaggaga
cactcggaaaccttcattgcactgtgcaccacagactgtacttttattgcactacctcct
tctctggtcgctgcagctagtttagcagctgcagtgaatggactggggccagaaaatctg
gggataagttattccagcttggcaaccacaaactaccttgcacaagccatccgctgtgac
ccaaatatcctgagaatgtgtcaagaacagattgaagcatccctacaatccaacctccag
gaagctgaaagaaaccaagtaccagtctccaaggctgtggaggaaattgaacgggccagc
acccccacagacgttctagactttgacttataa

DBGET integrated database retrieval system