KEGG   Nanorana parkeri: 108793627Help
Entry
108793627         CDS       T04897                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
npr  Nanorana parkeri
Pathway
npr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108793627 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108793627 (HDAC4)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108793627 (HDAC4)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108793627 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 108793627
NCBI-ProteinID: XP_018420129
LinkDB All DBs
Position
Unknown
AA seq 1067 aa AA seqDB search
MSSQIHPDGISDRDQPVELITQTRAKHMPSTVDVSAALPLQVASGTLPMDLRLDPQYPLP
GTDTSGREQQLQQELMTLKQKQQIQRQLLIAEFQRQHEQLSRQHEAQLHEHVKQQQELLA
MKHQQELLEHQRKLEQHRQEQEIEKQQREQKLLQLKHKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRSLNHCMSSDPRFWKTQHSSLDQSPPPQGGVSGSYHHPVLGMYDSKDDFPLR
KTASEPNLKLRSRLKQKVAERRSSPLLRRKDCPGVTTLKKRPMDMSDSACNSAPGSGPSS
PNNSSSNITTENGIAGPLGIQSEAALAHRLASREGSVTQLPLYTSPSLPNITLGLPASGS
ANGASGQETERISLSTIQQRLSLFPAAHLTPYLGSDAATSHNSLLQHMVLLEQPNAQSPL
VSGLGALPLHSQSLVSSDRVSPTIHKLRQHRPLGRTQSAPLPQNSHALQHMVIQQQHQQF
LEKHKQQFQQQQIHLNKMIPKVNEVSRQHESHPEETEEELREHQALHEEPYNVEHASEQK
EQSLCSIVHVKQEREESEDESNTHELEQNTLHTDQDLLFRQQTLLLEQQRIHQLRNYQAS
MEAAGLIIPFSGHRPLSRAQSSPASASFPMSVQETPTKPRFTTGLVYDTLMLKHQCICGN
TNIHPEHAGRIQSIWSRLQETGLRSMCECIRGRKATLEELQTVHSEAHALLYGTNPLNRQ
KLEGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELASKVVAGGLKNGFAA
VRPPGHHAEESTPMGFCYFNSVAVTAKLLQQRFNVEKTLIVDWDVHHGNGTQQAFYSDPS
VLYISVHRYDDGNFFPGSGAPDEIGSSAGAGFNVNVAFTGGLDPPMGDAEYLAAFRTVVL
PIAREFSPDVILVSAGFDAVEGHASPLGGYQVSAKCFGYLTKQLMGLAGGRIILALEGGH
DLTAICDASESCVSALLGNELEPISESVLQQRPNSNAVNSLEKVIQIQSEYWPCLHNVSS
TVSYSLVEAQKCENEEAETVTAMASLSVDVRPERRTEDEPMDEEPPL
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccagattcatccagatggaatatctgatcgggaccaaccagtggagcttata
acacagactcgtgccaaacacatgccaagcactgttgatgtttctgctgcgctgccactt
caggtggcctctggcacccttcctatggaccttcggctggatcctcagtatcctctccca
gggacagacactagtgggagggagcaacagctgcagcaagaactgatgacactaaagcag
aagcagcaaatacagcggcagctccttatagcagagtttcaaagacagcatgaacagctg
tcaagacaacatgaagcccagctacatgaacatgtaaagcaacaacaagagctcctggcc
atgaaacatcaacaggagcttttggagcaccagagaaagttggaacagcatcggcaggag
caagaaatagagaaacagcagcgggagcagaaactgttacagctgaagcataaggaaaag
ggaaaagaaagtgctgttgcaagcactgaagttaaaatgaagttacaagagtttgttctg
aacaaaaagaaagcccttgctcaccgtagcctaaatcactgcatgtctagtgaccctcgc
ttctggaaaactcagcatagctccctggaccagagtccaccacctcagggaggggtatct
gggtcataccaccatcctgtcttgggaatgtatgactcaaaggatgacttccccctaaga
aagacagcatctgagcccaatctcaagttacgttccagactgaagcagaaggttgcagag
cgcagaagcagccctctcctaagaaggaaagattgccctggagtgactactttgaagaag
cgtcctatggatatgtctgactctgcttgcaatagtgcacctggttctggccctagttcc
cccaacaacagctcaagcaacatcaccactgagaatggcattgctggtcctttgggcatc
caatcggaggctgctctggctcatagactggcgagcagggaaggctctgtgacccagctc
cctctctatacctcaccctctttacccaacataactctgggactgcctgccagtggatct
gctaatggtgcttctggacaagagactgagcgcatttccctttctactatccaacagcga
ctttctttgtttcctgctgcacacctcactccttaccttggttctgatgcagcaacttct
cataattcacttttgcaacatatggtcctgctagagcagcccaatgcacagagcccattg
gtttcagggttgggagcactccctcttcactcccagtctttagtgtccagtgatcgggtt
tcccccacaatccacaagttacgtcagcaccgcccattgggccgaacacagtctgcacct
ctgcctcagaactctcatgccctgcaacacatggtcatccagcagcagcaccagcagttc
ctcgaaaagcacaaacagcagtttcaacagcagcagatacatcttaataagatgattcct
aaagtaaatgaggtttcacgacaacatgaaagccaccccgaggagaccgaggaagagctc
cgtgaacaccaagcattacatgaagagccatataatgtagaacatgcatccgagcaaaag
gagcaaagcctttgcagtattgtgcatgtaaagcaggagagggaagagagtgaggatgaa
tcaaatacacatgagctagagcagaatacattacacactgaccaggatctgttgttcaga
cagcaaacactactacttgaacagcagcgaattcatcagctgaggaattatcaggcctcc
atggaagctgctggattaataataccttttagtgggcacaggccgctatccagggcacag
tcttcaccagcctctgcctcttttcccatgtccgttcaggaaactcccactaagcccagg
ttcactacaggtcttgtgtatgacaccttgatgcttaaacatcagtgtatctgtggaaac
acaaatatccatccagagcatgctggccgaattcagagcatctggtccaggttgcaagag
actggtttaagaagcatgtgtgagtgtatacgtggcagaaaagccactttggaggagttg
cagactgtccattctgaagctcatgctctgctctatggcaccaaccctttgaatcgacaa
aaactggagggatctttgacctccatgttcgttcgtctcccatgtggcggggttggggtt
gacagtgatacaatctggaatgaagttcattcttctggagctgcccgtctagcagtgggg
tgtgtggtggaacttgcctcaaaggttgtggcaggggggttaaagaatggctttgctgcg
gtccgccctcctggtcatcatgctgaagagagcacacctatgggtttctgttacttcaac
tctgtcgcagttacagcaaagctccttcaacaaagatttaacgtggagaagacattgata
gtggattgggatgtgcatcatggaaatggtacccagcaggctttctatagtgatccttct
gtcctttatatatcagtccatcgctatgatgatggaaacttcttcccaggaagtggggct
cctgatgagattggaagcagtgctggtgcgggttttaatgtgaatgtggcttttactgga
ggactggacccgcctatgggggatgcagagtacttggctgcattcaggactgtggtgttg
ccaatagctcgtgaattttctccagatgttatcttggtgtctgcagggtttgatgctgtg
gaaggacatgcctctcctctaggagggtaccaggtatcggccaaatgttttggatatctg
acaaagcagcttatggggttggctggaggtcgtattattctggcacttgaaggaggtcat
gacttgacagcaatttgtgatgcttctgaatcttgtgtatctgctctactaggtaacgag
ttagagccgatttcagagtctgtgctacaacagagaccaaatagcaatgcggtgaactct
ttggagaaagtcattcagatacaaagtgaatactggccatgtttgcataatgtttcttct
acagtctcctattctcttgtcgaggcacagaaatgtgagaatgaagaagccgagacagtg
acagcgatggcatccctgtctgtggatgtccgtccagagagaagaacagaggatgagccg
atggatgaagaaccccctctgtag

DBGET integrated database retrieval system