KEGG   Nanorana parkeri: 108794066
Entry
108794066         CDS       T04897                                 

Gene name
SUV39H2
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H2
  KO
K11419  [histone H3]-lysine9 N-trimethyltransferase SUV39H [EC:2.1.1.355]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108794066 (SUV39H2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108794066 (SUV39H2)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     108794066 (SUV39H2)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108794066 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108794066 (SUV39H2)
SSDB
Motif
Pfam: SET Pre-SET Chromo Chromo_shadow
Other DBs
NCBI-GeneID: 108794066
NCBI-ProteinID: XP_018420543
LinkDB
Position
Unknown
AA seq 408 aa
MEFSVVSSAAWCVPCLASNETLQEICRKESLICKCIGINRRNLNNYEVEYLCDRKMEKGA
EYFFVKWKGWPESYNTWEPVANLKCPALLEHFYNDLYIYLSKLNAGKLNKIKKNIKSVGN
SAADFIVKKAKQRIALKRWEEELNRKKTHAGMLYVENDVDIEGPPRDFYYINDYKTTPGV
NTLGEAIVGCECTDCFTGICCPNEAGVLFAYNEHKQIRIPPGRPIYECNARCKCGPDCPN
RVVQKGPPYSLCIFRTENGRGWGVKTLQKIKKNSFVMEYVGEVITSEEAERRGQQYDSTG
ITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVYNVFIDNLDVRLPRIALFSTRP
IKAGEELSFDYQMKGSGDFSTDSIELSPAKMRVRTACKCGASTCRGFL
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggagttcagtgttgtctcctctgcagcttggtgcgtgccatgtcttgcctctaatgaa
acccttcaagagatatgccgcaaggaatccctgatctgcaaatgcatcgggataaacaga
agaaatcttaataattatgaagtggagtatctctgtgaccgtaaaatggaaaagggtgca
gaatacttttttgtgaaatggaaaggatggccagagtcgtataatacatgggaacctgtt
gcaaacctcaagtgcccagcacttttagaacatttttacaatgacctttacatctattta
tctaaattaaatgctggtaaattaaataagataaaaaaaaacattaaatctgtgggcaac
tctgctgctgactttatagtgaagaaggctaaacaacgaattgcactcaagcgctgggag
gaggaactgaacagaaaaaaaactcatgccggaatgctctatgtagaaaatgatgtagac
attgaggggcctcccagagacttctattatattaatgattacaagaccacacctggagtt
aataccttgggtgaagccattgttggctgtgaatgcactgactgctttacaggtatatgt
tgccctaacgaggcaggggttctttttgcttacaatgagcacaaacaaattaggattcca
cccggacgccctatttatgaatgcaacgctagatgtaaatgtggtccagattgtcccaac
cgagtggtacagaaaggacccccctactctctatgcatctttaggacagagaatggacgt
ggctggggggttaaaacgcttcagaaaatcaagaagaacagctttgttatggaatatgtt
ggtgaggtaataacaagtgaagaggcagaaagaaggggtcagcagtatgacagcacggga
atcacttacctatttgatctggactatgagtcagatgagttcactgtggatgctgctcga
tacgggaatgtctcacactttgtaaatcacagttgtgatcccaaccttcaagtgtataat
gtcttcatagacaatcttgatgtgcgcctccctcgtattgcattattttcaacaagacct
attaaagctggagaagaactctcatttgactaccaaatgaaaggttctggagattttagt
acagattctattgagctaagtcccgctaaaatgagagtaaggacagcttgcaaatgtgga
gcttcaacttgcagaggattcctttaa

DBGET integrated database retrieval system