KEGG   Nanorana parkeri: 108795789Help
Entry
108795789         CDS       T04897                                 

Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
npr  Nanorana parkeri
Pathway
npr00010  Glycolysis / Gluconeogenesis
npr00051  Fructose and mannose metabolism
npr00052  Galactose metabolism
npr00500  Starch and sucrose metabolism
npr00520  Amino sugar and nucleotide sugar metabolism
npr00524  Neomycin, kanamycin and gentamicin biosynthesis
npr01100  Metabolic pathways
npr01200  Carbon metabolism
npr04910  Insulin signaling pathway
Module
npr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
npr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108795789
   00051 Fructose and mannose metabolism
    108795789
   00052 Galactose metabolism
    108795789
   00500 Starch and sucrose metabolism
    108795789
   00520 Amino sugar and nucleotide sugar metabolism
    108795789
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108795789
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108795789
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:npr04131]
    108795789
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108795789
Membrane trafficking [BR:npr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108795789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108795789
NCBI-ProteinID: XP_018422592
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMSRFKKEMEDGLSRDTNPTTI
IKMLPTFVRSIPDGTEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYDSPEDIIH
GTGTRLFDHVAECLGDFIEKKQIKDKKLPVGFTFSFPCMQSKLDEGILLTWTKRFKASGV
EGMDVVKLLNKAIKKRGDYDAEIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIEKSKEGLSKAKDILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLIASTLGGILARLRDNKGVPRLRTTVGIDGSLYKMH
PQYSRRLHKTVRRLLPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQRRQMDETLEEFSLS
KEQLQEVKRRMRIEMECGLKKKTHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPTDVMQGTGDELFDHIVHCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLTWTKGFKSTDCEGEDVVTLLREGIKRREEFDLDVVAIVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEELKNIEMVDGDEGRMCVNMEWGAFGDNGCLDD
IRTVYDKAVDELSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTS
IFETKFLSQIESDRLALLQVRSILQQLGLNSTCDDSIIVKEVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLEVTVGVDGTLYKLHPHFSRIMHQTVADLAPKCNVSFLLSEDGSGKG
AALITAVGCRLRETEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatagcagcccagctcctggcctattacttcactgagctcaaagatgatcaggtcaaa
aagatcgacaagtatttgtacgcaatgcggctctccgatgaaaccttactggatattatg
tcccggttcaaaaaggaaatggaagatggcctgtcaagggataccaacccaacaacaatt
atcaagatgcttcccacttttgtgagatccattcccgatgggacagaaaagggagatttc
atcgctctggatctcggtgggtcatattttcggatcctgcgggtgaaggtttcacatgaa
aagaagcaaacagtgcaaatggaaagtgagatctatgattcaccagaggacattatccat
ggcacaggcactaggctttttgaccatgttgcggaatgcctgggagatttcatagagaag
aagcagatcaaagacaagaagctgcctgtcggattcaccttttccttcccctgcatgcag
tctaaactagatgagggcattttgctgacctggactaaaagatttaaggccagcggggtt
gaagggatggatgtggttaaattgttaaacaaggccatcaagaagcgaggggactatgat
gcagaaattatggctgtagtgaatgacacagttggcaccatgatgacctgtgggtttgat
gatcagagatgtgaagttggcataatcattggtactggaacaaacgcctgttacatggag
gaactgaggcacattgatttagtagaaggagacgagggcaggatgtgtattaacacagaa
tggggagcatttggagatgacggctctttggaggacattagaacagagtttgatagagag
atcgaccgaggctctctaaatccaggaaaacaactatttgaaaagatggtgagtggcatg
tatatgggagaactggtcagacttatactggtaaaaatggccaaagaaggtcttctgttt
gaaggaagaatcactccagaactcttaactagagggaagttcgagaccaagcatgtgtct
gccattgagaagagtaaagaaggattaagcaaagccaaagatatactgacacggttagga
gtggaaccttcccatgaagactgcattgctgtacaacatgtgtgtacaatcgtttccttc
cgttccgccaacctgatagcttctacactgggtggtatccttgctcgcctccgggacaat
aaaggagtccccaggttgcgaaccacagtaggcattgatgggtcactttacaagatgcat
ccacaatactcccgacgtctgcataaaacagtgagacgcttgctccctgactgtgatgtg
cgttttttgctgtcagagagtggcagtggtaagggtgctgctatggtgacagcggtggct
tatcggctggcagagcaaagacgacagatggatgagacacttgaggagttcagcctcagc
aaagagcagttacaggaggtaaagaggagaatgcgaattgagatggaatgtggattgaag
aaaaaaactcacgaaactgcaaaggtgaagatgctgccaacgtttgttcgcagtacacca
gatggcacagaaaatggtgattttctggccctggatcttggaggaacaaacttcagagta
ttacttgtaaagataagaagcggtaaaagacgaactgtggaaatgcataataaaatctat
gccatccctacagatgtcatgcaaggcactggagatgagctctttgaccacattgttcac
tgcatctcagatttccttgactacatggggattaaaggagcccggcttcctttgggattc
accttctccttcccctgcaagcagaccagcttagacgctggtatcttgctaacctggacc
aaaggcttcaagtcaaccgactgtgagggtgaggatgtagtgactttactaagagaagga
atcaagaggagagaggaatttgacctggatgtagttgccatagtaaatgatacagttgga
acaatgatgacttgtgcatatgaagatcctaactgtgaaattggtctcattgtgggtact
ggcagcaatgcttgctacatggaagagctgaaaaatatagaaatggtggatggagatgaa
ggcagaatgtgcgtcaatatggaatggggagccttcggtgataatgggtgcctggatgac
atcaggacagtatatgacaaagctgttgatgaactgtctctaaactcaggaaaacaaagg
tatgagaagatgatcagcggaatgtatttaggagaaattgtacgtaatattttaattgac
tttacaaaaagaggattcctttttagaggtcagatttcagaggcactgaaaacaacgagc
atctttgaaaccaaattcctttcacagattgagagtgacagactagccctgctgcaagta
cgatccatccttcagcagctgggtctgaacagcacctgtgatgacagtatcattgttaaa
gaggtgtgtggcgtggtatcgaaaagggcggcacagctatgtggtgctgggatggcagct
gtggtggataagataagggaaaacagaggcctggaccatctggaggttacagttggagtt
gatggaacactgtataagcttcatccacatttctccagaatcatgcaccagacagtggca
gatctcgctcccaagtgcaatgtgtccttccttctctccgaggacggcagtggaaaagga
gcagctcttattactgctgtgggatgcagacttcgtgaaactgagcagaattaa

DBGET integrated database retrieval system