KEGG   Nanorana parkeri: 108796074Help
Entry
108796074         CDS       T04897                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
npr  Nanorana parkeri
Pathway
npr00010  Glycolysis / Gluconeogenesis
npr00052  Galactose metabolism
npr00500  Starch and sucrose metabolism
npr00520  Amino sugar and nucleotide sugar metabolism
npr00524  Neomycin, kanamycin and gentamicin biosynthesis
npr01100  Metabolic pathways
npr01200  Carbon metabolism
npr04910  Insulin signaling pathway
Module
npr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
npr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108796074 (GCK)
   00052 Galactose metabolism
    108796074 (GCK)
   00500 Starch and sucrose metabolism
    108796074 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    108796074 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108796074 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108796074 (GCK)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     108796074 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108796074
NCBI-ProteinID: XP_018422966
LinkDB All DBs
Position
Unknown
AA seq 458 aa AA seqDB search
MEHKMHPDVEQMLAEFQLHEEDLQVLLDRLQAEMDRGLHLETNEEASVKMLPTYVRSTPD
GSEVGDFLALDLGGTNFRVMLVKVGEDLDGLWKVDTKHKMYSIPEDAMTGTAKMLFDYIA
ECISDYLDQQNMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRD
AIKRRGDFEMDVVAMVNDTVATMISCYYEDHHCEVGLIVGTGCNACYMEEMCNVELVEGE
EGRMCVNTEWGAFGDTGELEDFRLEYDRVIDEGSLNPGQQLYEKMIGGKYMGELVRLVLM
KMVNENLVFGGEASEKLKTKGSFESQFVSQVEGDSSDFRQTCNILRTLGMQPTLADCQAV
HMACESVSTRAAVMCGAGLAGVLKHMHKNRGDDILQITVGVDGSVYKLHPTFKDKFHATV
HKLAQSCDITFIQSEEGSGRGAALISAVAYKMACLIGH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaaaatgcatcccgatgtggagcagatgctggcagagttccagcttcacgaa
gaagacctgcaggtattgttggacaggttgcaggcagagatggatcgaggtcttcacctg
gagaccaatgaagaagctagtgtgaaaatgctgcctacttacgtacgatctacacctgat
ggctctgaggttggtgactttctggccttggatctcggtggcacaaatttccgtgtgatg
ctggtgaaagtcggagaggatctggatggactgtggaaagtagacacaaagcacaaaatg
tattcgattcctgaggatgcgatgacaggaactgcaaagatgctgtttgattacattgct
gaatgtatctctgattacctggaccagcagaacatgaagcacaagaagctcccgctggga
tttaccttctcctttcctgttagacatgaagacattgacaagggcatacttctgaactgg
accaaaggttttaaagcgtcaggagcagagggaaacaatgtggttgggctgctaagagat
gccatcaagagacgaggggattttgagatggatgttgttgccatggtgaatgacactgtt
gctacaatgatatcttgttactatgaagatcatcactgtgaagttggcttgatagtgggc
actggctgcaacgcctgctacatggaagagatgtgcaatgtggagctggtggaaggagaa
gagggacgcatgtgtgtcaacacagaatggggagcattcggggatacgggagaactggaa
gatttcagactggaatatgaccgagtgatagatgaaggctctctaaatcctggtcagcaa
ctctacgagaagatgattggtggaaagtacatgggcgaactagtcaggctggtcctgatg
aaaatggtgaatgaaaatctggtgtttggtggcgaggcctctgaaaaactgaagacaaag
ggaagttttgaatcacagtttgtgtctcaagtagaaggagattcttcagatttcagacag
acttgcaacatcctgcggacactgggcatgcagcccacactggcggattgtcaggctgtg
cacatggcctgtgaaagtgtgtccacacgagcggctgttatgtgtggtgctggcctggcc
ggcgtactcaagcatatgcataaaaaccgaggtgacgacattctgcagatcacagtggga
gtggatggatccgtttacaagctccaccccactttcaaagacaagtttcacgctacagtt
cacaagttggcccagtcttgtgatattaccttcatccagtcagaggaaggcagtggtaga
ggagctgctctgatatctgcagtggcttataaaatggcttgtcttattggacattaa

DBGET integrated database retrieval system