KEGG   Nanorana parkeri: 108796324
Entry
108796324         CDS       T04897                                 

Gene name
EZH1
Definition
(RefSeq) histone-lysine N-methyltransferase EZH1 isoform X1
  KO
K17451  [histone H3]-lysine27 N-trimethyltransferase EZH1 [EC:2.1.1.356]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108796324 (EZH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108796324 (EZH1)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.356  [histone H3]-lysine27 N-trimethyltransferase
     108796324 (EZH1)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108796324 (EZH1)
   Polycomb group proteins
    PRC2-EZH1 complex
     108796324 (EZH1)
SSDB
Motif
Pfam: PRC2_HTH_1 SET preSET_CXC EZH2_WD-Binding
Other DBs
NCBI-GeneID: 108796324
NCBI-ProteinID: XP_018423284
LinkDB
Position
Unknown
AA seq 710 aa
MEPPSPQFTKSLLYWKKRARLEYMRLLQLKRMQANTAAGALYVENLAKAQDRMNLLLEER
QTVRVQPIEMMTPSSGLPFLKKVEDETVLCNIPYMGDNAKAEDETFIEELINNYDGKVHG
EEERAVLCAGAGVLDDAIFLDLVDALLQYSDEGEKAYDDPVASKGEEVKADGPMTRKRKK
IAEEGSKKICKSHFPNDLIFSAISAVFPERGFPDEVKERYKELTSSSDPNALPPQCTPNI
DGLGAKSVPREQSLHSFHTLFCRRCFKYDCFLHPFHASPNMCRRRNREIKIETEPCGNHC
FLWLEGAKEYAVMNNPRLKCLGRRRKKNSTNTNSSSGASTSGLAEAKEGDSDRDTGNECV
SSSSEANSRCQTPTRQRQGSGSGELPDVSEPSEPAEWSGAEESLFRVFHGTYFNNFCSIA
KLMGTKTCKQVFQFAVKDSLILKLPARELMSTAQKKKRKHRLWAAHCRKIQLKKDNSSNL
VFNYQPCDHPDHPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLA
VRECDPDLCLTCGASEHWDSKIVSCKNCSIQRGLKKHLLSAPSDVAGWGTFIKESVQKNE
FISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDYVVDATRKGNKIRFANHSLNPNCY
AKVVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERESDAV
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggagccacccagcccacaatttaccaagtctctcctttactggaagaagagagctcgt
ctggagtacatgcgtcttctacagctaaagagaatgcaggccaacactgcagctggggcc
ttatatgtggagaatttggcaaaggctcaagatcggatgaaccttttgcttgaagagcgg
cagactgttagagttcaaccaattgagatgatgacgccttcaagtgggctcccctttcta
aaaaaggtggaagatgaaactgttctgtgtaacatcccctacatgggggataatgctaaa
gcggaggatgaaacctttattgaagagctcatcaataactatgacgggaaggtgcatggt
gaagaagagagagctgtcttatgtgcaggtgctggtgtcttagatgatgctatcttcttg
gacttggtggacgctctacttcagtattcagatgaaggggagaaggcgtatgatgaccca
gtggcaagcaaaggagaggaggtgaaagcggatggtcccatgaccagaaagagaaagaaa
atagcagaggagggcagtaagaaaatctgtaaaagccactttcccaatgatctgatcttt
agcgcaatctcagcagtgtttccagagagaggttttccagatgaagtcaaggagaggtac
aaggaactaacttcttcatcagaccccaatgctcttccaccacagtgcactcctaatatt
gatggcctcggtgccaaatctgtgccaagagagcaatctctgcactcttttcacaccctc
ttctgtcgccgctgttttaaatacgattgcttcttgcacccatttcatgcaagtcctaat
atgtgcagaagacgaaaccgagaaattaagattgagactgaaccatgtggaaaccactgc
ttcttgtggctggagggtgccaaagagtatgctgtgatgaacaaccccagattgaagtgc
ttgggaagacgtcgaaagaaaaattcaactaatactaattccagctctggtgcctccact
tctggcttggcagaggccaaagaaggtgacagtgatcgagacactggaaatgaatgtgtt
tccagctcttccgaagctaattcacgttgccaaacacccactaggcagaggcagggaagt
gggagtggggagttgccagatgtgtcagagcccagcgagccagcagagtggtctggagct
gaggaatctctcttcagggtcttccatggaacctacttcaacaatttctgctctattgct
aagctaatgggcaccaagacatgcaaacaggtttttcagtttgctgttaaagactcactc
attctgaaattgcctgccagagagcttatgagcaccgctcagaagaagaaacgaaaacac
agattgtgggctgcacactgtagaaagattcagcttaaaaaggacaattcatccaatctg
gtgttcaactaccagccctgtgaccatccagatcatccttgtgatagtacttgtccatgt
atcatgacacagaacttctgtgagaaattttgtcagtgcaaccctgactgtcagaaccgc
ttccctggatgcagatgtaagacgcagtgcaataccaagcaatgtccatgttatctggct
gtccgtgagtgtgacccagatctctgcctcacttgtggtgcctctgagcactgggactct
aagattgtgtcctgcaagaactgcagtatccaacggggtctaaagaagcacttgctgtcg
gccccctctgatgtggctggctggggaaccttcatcaaagagtctgttcagaagaatgag
ttcatatctgagtactgtggtgagctgatttcccaggatgaagcagatcgaagagggaag
gtttatgataaatatatgtcaagctttctgttcaatcttaataatgattatgttgtggat
gccacaaggaaagggaataaaatccgttttgctaaccactctttaaatcctaactgttac
gctaaagtggtcatggtaaatggagatcatcgtattggtatatttgctaagcgagcaatc
caggccggggaagaattgttctttgactacagatacagccaggcggacgctctgaaatat
gtgggcatagaacgagaatcagacgccgtctaa

DBGET integrated database retrieval system