KEGG   Nanorana parkeri: 108796444Help
Entry
108796444         CDS       T04897                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
npr  Nanorana parkeri
Pathway
npr00052  Galactose metabolism
npr00500  Starch and sucrose metabolism
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108796444 (GANC)
   00500 Starch and sucrose metabolism
    108796444 (GANC)
Enzymes [BR:npr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108796444 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108796444
NCBI-ProteinID: XP_018423427
LinkDB All DBs
Position
Unknown
AA seq 729 aa AA seqDB search
MQPDWILQDAFGLWKEKFGDFEDIKANGPSSVGLDFTLYGFENVYGLPEHADVHSLKDTG
ENEAYRLYNLDVFGYSVYDKMGTYGSVPLLLAHKPSYTCGIFWLNASETLVEIHSKAALQ
VSVMDWDSRQKAVPKMDVRWMSESGIVDVFLLLGPMPQNVFNQYAQLTGTQMLPPLFSLG
YHQCRWNYEDEADVEAVDSGFDEHSIPYDVIWLDIEHTDGKRYFTWDPDRFPDPVKMQEK
LREKRRKLVVISDPHIKVDPNYTLYAEAKEKGYFVKDREIGNFEGTCWPGLSSYIDFTNP
AAREWYSSQFSLDKYKSSTDVLYVWNDMNEPSVFDAPEMTMPKDAVHHQGWEHRDLHNLY
GFYQQMSTSDGLIQRSGGKERPFVLTRSFFAGSQRYGAVWTGDNKAEWEYLKISVPMLLS
LSVTGIAFCGADVGGFVGDPDLELLVRWYQAGAFQPFFRGHAMQDTKRREPWLFGEENTL
LIRKAIHERYTLLPYWYLLFYRAYRTAEPVMRPLWVEFPKCQDAFAVASQYMLGNALLVA
PVLDSGVKSIEVLFPGNGECWYDFRKYTRVKGSHRQKVAVTVAEIPVFQRGGSIIPMHTT
VGKSTGWMACTPYELHVALDRKGFAAGELYVDDGHSLQYLHEHMYSHRRFTFSRNVLSSS
SADKEGHHTVNCFLEKVYIIGLKKSPSEVTAHDCGGKKTVEFTYNSQLCLLSLENLSLQV
CADWEIHIV
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagattggattttacaggatgcgtttggactctggaaagaaaagtttggagat
tttgaagacattaaagccaatggtccctcttctgtggggctggattttaccttgtacggg
tttgaaaatgtttacggactgccagaacatgctgatgtccacagcctcaaagatacagga
gaaaatgaggcataccggctctacaatttggatgtgtttggatacagtgtctatgataaa
atgggcacatatggatctgtacctttactgctggcacacaaaccatcatacacctgtggc
atcttctggcttaatgcctcagagacattagtagaaatccattccaaagctgccttacag
gtaagtgtcatggattgggactcacggcaaaaggcagtacccaaaatggacgtcagatgg
atgtcagagagcgggatagtggatgtctttcttttactgggacctatgcctcaaaatgtt
ttcaaccagtatgcacagctgacaggtacccagatgcttcctcccctcttctcactgggt
tatcatcagtgtcgctggaattatgaagatgaggcagatgtggaagctgtggactcaggg
tttgatgaacacagtattccctatgatgtcatctggttggatatcgagcacaccgatgga
aagaggtattttacatgggaccctgacagatttcctgaccctgtaaagatgcaagagaaa
ctgcgggagaaaaggcgcaagctggttgtgatctctgacccccacattaaagttgatcca
aactacaccctgtatgcagaggccaaagaaaaaggatactttgtgaaagaccgagaaatt
gggaattttgagggcacctgctggccaggtttgtccagctacatagacttcacaaatcct
gcagcacgtgagtggtactcgtctcagttttcacttgataaatacaaaagctctactgat
gtcttgtatgtgtggaatgacatgaatgagccctctgtgtttgatgctccagagatgacc
atgccaaaagatgctgtacaccaccagggatgggaacacagggatcttcataatctctac
ggcttttaccagcaaatgtccacttcagatggcctaattcaacggtctggagggaaggaa
agaccctttgtgctaacaaggtctttctttgctggttcacagcgttatggtgcagtatgg
accggagataacaaagcagagtgggagtatttaaaaatctcagttccgatgttacttagt
ctcagtgtgacaggaatagccttctgtggagctgatgttggaggatttgttggagaccca
gacctcgaactactggtccgttggtaccaggctggcgcattccagcctttctttcgtggt
cacgctatgcaggataccaaacgcagagagccttggttgttcggtgaagaaaatactctc
ttaatcaggaaagcgatacatgaacggtatacactccttccatactggtacctgctgttt
tacagggcataccgcacagctgagcctgtaatgaggcctttatgggttgaatttcctaaa
tgccaagatgcctttgcagtggcaagtcagtacatgctagggaatgcactactggttgcc
ccagtattagactcaggtgttaaatccattgaagttctctttcctggcaatggagagtgc
tggtatgacttcaggaaatatacacgtgtgaaggggtctcacagacagaaagtggcagtg
actgtggcagagattccagtatttcagaggggtggatccattatccccatgcacacaaca
gttggcaagtcaacgggttggatggcgtgtactccatatgagttacatgttgcactagat
cggaagggatttgctgcaggggagctctatgtcgacgatggccactccttgcagtacctg
catgaacacatgtatagtcatcgaagatttacattttcaagaaatgttctgagctcaagt
tccgcagataaagaaggtcaccacacagtgaattgcttcctggaaaaagtttatataata
ggtttgaagaaatcaccttctgaagtcactgcacatgactgtggaggaaagaaaacggtg
gaattcacgtacaacagccaactttgccttctgagcctggagaacctgtccctgcaagtc
tgtgcagactgggagatccacatagtctga

DBGET integrated database retrieval system