KEGG   Nanorana parkeri: 108796572
Entry
108796572         CDS       T04897                                 

Gene name
ZBTB49
Definition
(RefSeq) zinc finger and BTB domain-containing protein 49
Organism
npr  Nanorana parkeri
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_6 zf-met zf_UBZ GAGA zf-C2HC_2 Zn-ribbon_8 zf-Di19 zf-C2H2_3rep C1_4 zf-C2H2_8 zf-LYAR
Other DBs
NCBI-GeneID: 108796572
NCBI-ProteinID: XP_018423567
LinkDB
Position
Unknown
AA seq 735 aa
MDRTASHSCHLLQQLHEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSQYFRSLFQNTSVQ
KNDVFHLDIKNIGGIGQILDFMYTSHLDLNNDNIQAMLDIAQCLQVQNVLNMCYNFLKLT
TNVEPVAPIPCSNSEPLQGNYSEFTNSVSGEQLSTPTLEDPITEARHSQPLLAGKGSVSS
NEVPKPTSVTVNSSNKEIQLKQYGQPYKLRDFYSKLFYKENADKAAEQAATATIESNLTE
SQPWTLTPSESILAPSDSLPLEPLPAFSHTFVSSQDQEAPPLQFPTEMRLKKAIHLKKLN
FLRSQKAAEESAPPIEVLQNTIEETVFTNEVLDNTEKTFLEKEVDSEILENVAENVEVER
AESPNLEDSGVPVPKHCACDLCGKTFKHPSNLGLHKRSHTGEKPFECSVCGKHFSQAGNL
QTHLRRHSGEKPYICEICGKRFAVSGDVQRHIVIHTGEKPHLCDICGRGFSNISNLKEHE
KTHATDKLYTCDDCGKSFNMYRKLIKHRIRHTGDRPYSCMTCGKRFGGSGDLRRHVRSHT
GEKPYTCDVCNKSFSRSAVLRRHKKMHCKAGDGDQVTEEEFPDPAESSNLDKAQNVDSVT
QNISVAFIQEHSVENTRNDYEGSTANPYCKLQSMIQQDTGQDKNISERTKTTKPHLADTG
EAYTFTEVEVSEDSVHTDISMIRSSLVTLENNCNEPLNNRASSNGYRGSDGPFFSSMSLW
GLAMKTLQNETDMEQ
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggaccggactgcaagtcacagttgccatcttctacagcagctgcacgagcaaaggatc
cagggcttgctgtgcgactgcatgctggtggtgaaaggagtctgcttcaaagcacataaa
aatgtgctggcagctttcagccagtattttagatctctgtttcagaatacctcagtccag
aaaaatgacgtctttcacttggacatcaagaatattggaggcataggtcaaatcctggac
tttatgtacacctcgcaccttgacctgaataatgataacatacaagccatgttggacatt
gcacagtgcctccaagtacaaaacgtcttgaatatgtgttacaatttcttaaaactaacc
acaaatgtggagcctgtggctcccattccatgtagcaactccgaacccctacaggggaat
tactcagagtttacaaactctgtatctggcgaacagctaagcactccgacacttgaggat
cctataactgaggccagacattcccagccattgttggcgggtaagggcagtgtttcctca
aatgaggttcctaaacccacatctgtcaccgtcaactcaagtaataaggaaatccagtta
aagcagtatggtcagccctacaaactgcgggacttttacagtaaactcttctacaaggag
aatgcagacaaggcagcagagcaggctgcaacggccaccattgagtctaatttgacagaa
tcacaaccatggactttgactccttctgagtcgatattagccccatcggattctttaccc
ctggaacccttgcctgcgttttctcatacctttgtttcctcccaggatcaagaagcacca
ccactacagttccctacagaaatgcgacttaaaaaagccattcacctcaagaaattgaac
ttcctcaggtctcagaaggcagcagaagagtcggctccgccaattgaggtcttgcagaac
actatagaggaaacagtgttcacaaatgaggtattagacaatacagaaaagacctttcta
gaaaaagaagttgacagtgaaatactcgagaatgttgctgagaatgtggaggtagaaaga
gcggagagccctaacttggaagattcgggtgtaccggtacccaagcactgtgcatgtgac
ttgtgtggcaagaccttcaaacaccccagcaacctggggctgcacaaacgttctcacaca
ggagagaaaccttttgagtgtagcgtttgtggcaaacacttctcacaggctggaaatctt
cagactcatttacgaaggcactctggtgaaaaaccttacatatgcgaaatttgtggcaaa
aggtttgcagtctctggtgatgtgcagcgccacattgtcattcacacaggggagaaacca
cacttgtgtgatatctgcgggagaggttttagtaatatcagcaacttgaaggaacacgag
aagactcacgccacagacaaactgtatacctgtgatgactgcggtaaatccttcaacatg
taccgcaagctaataaagcacagaatccgccacacaggagaccgaccgtacagttgtatg
acatgtggcaagaggttcggtggctccggagacctgcgcaggcacgtcagatctcataca
ggggagaagccatacacatgcgatgtatgcaacaaaagcttctcccgctcagctgttctc
agacgtcacaaaaagatgcactgcaaggctggagatggcgatcaggtcacagaagaggag
tttcccgatccggcagaatcttccaatctggacaaagcacaaaatgtagattccgtcaca
caaaacatttctgtcgcttttatacaagaacattctgtggagaatacaaggaatgactat
gagggaagcacagcaaacccctactgcaaattacaaagcatgattcagcaagataccggc
caggacaagaatatctccgagcgtacaaaaaccacaaagcctcacttagcagacacaggc
gaggcctatacattcacagaggtggaggtatcggaggacagtgtacacacggacatatct
atgatacgttcctcattggtgactttagagaataactgcaacgagccactaaataaccga
gcctcatccaatggatacagaggctccgatggccccttcttctctagtatgtctctatgg
gggctcgctatgaagacgctgcagaatgaaactgacatggaacagtga

DBGET integrated database retrieval system