KEGG   Nanorana parkeri: 108796847Help
Entry
108796847         CDS       T04897                                 

Gene name
GALNT14
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 14
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
npr  Nanorana parkeri
Pathway
npr00512  Mucin type O-glycan biosynthesis
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    108796847 (GALNT14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:npr01003]
    108796847 (GALNT14)
Enzymes [BR:npr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     108796847 (GALNT14)
Glycosyltransferases [BR:npr01003]
 O-Glycan biosynthesis
  Mucin-type
   108796847 (GALNT14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 108796847
NCBI-ProteinID: XP_018423895
LinkDB All DBs
Position
Unknown
AA seq 554 aa AA seqDB search
MRRMARRLVLSLIGLVWVAILIFLLGGRRKLEAEESEGDGAKDADVDWDDLWDQFDERRY
LNAQRWKPGEDPYRLYAFNQRESERIPSDRAIKDTRHYRCTELHYSSDLPPTSVIITFHN
EARSTLLRTIRSVLNRTPMHLIHEIILVDDFSDNSDDCQLLCKLPKVKCLRNDRREGLIR
SRVRGADIAKAGVLTFLDSHCEVNKDWLPPLLQRIKENPTRVVSPVIDIINLDTFAYIAA
SSDLRGGFDWSLHFKWEQLSMEQKSKRSDPTEPIKTPVIAGGLFLIDKSWFNHLGKYDTA
MDIWGGENFEISFRVWMCGGSLEIIPCSRVGHVFRKKHPYVFPEGNANTYIKNTKRTAEV
WMDEFKNHYYAARPAAQGRPYGDIQKRLSLRRSLKCRPFKWYLENVYPELQIPTAPLSKS
GLIRQRQRCIDSQKTGGEDAPTLNLVPCSSLKGVPEKSQEWIYTQVQQISQQGLCLSVHT
LFPGTQVVLLPCKEGDGKQRWSKVGSHIEHMASHFCLDTEIIGDADENNREIVINPCETT
AISQRWEMVLQGFH
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggatggctcgccggctggtgctgtcactgatcgggctagtgtgggtggccatc
ctcatcttcttgctgggcggcaggaggaagttggaagccgaagaatccgaaggggacggt
gccaaggatgcggatgtggattgggatgatctgtgggaccagtttgatgaacgccgatac
ctgaacgcccagagatggaagcctggggaggacccctacaggctgtatgcgttcaaccag
cgggagagtgagaggataccaagtgatcgcgccattaaagacaccagacattacagatgt
acagaattgcactactcatcggatcttccacccacaagcgtcattataacttttcacaac
gaggcgagatcgacgctgctgagaaccatcaggagtgtgttaaacagaacacctatgcac
cttatccatgaaataattcttgtggatgacttcagcgataactccgatgactgccaactc
ctgtgcaagttacccaaagtgaagtgcttacgcaacgaccggagggaaggtttgatccgg
tcccgagtccgaggggcagacattgcaaaggccggagttcttacctttctggacagccac
tgtgaagtcaacaaggactggctccctcctctcctacaacgaattaaagagaacccaact
cgtgtggtgagtcccgttattgacattataaacctggacacctttgcctacattgcagca
tcttctgacctgagaggagggtttgactggagtttgcactttaaatgggaacaactctcc
atggagcaaaaatctaaaagatcggaccctacagagccaataaagactcctgtcatagct
ggaggactattcctaatcgacaaatcctggtttaaccacttggggaaatatgacacggcc
atggatatatggggaggagagaattttgagatctcatttcgtgtgtggatgtgcggggga
agcctggagatcatcccgtgtagtcgggtgggtcacgtgtttcgaaagaagcatccctac
gtgttccccgagggcaacgccaacacgtacatcaagaacaccaaacgcacggcagaggta
tggatggatgaattcaaaaaccattactatgcagcacgcccggccgcccaagggagacct
tatggagacattcagaagagactgtcgctgcggagaagcttaaaatgccgaccattcaag
tggtatttggagaatgtttacccggaactccaaattccaacagcacccttatcaaaatca
ggattaatcaggcagaggcagcgatgcattgattcccaaaagactggaggagaggatgcc
cctactttaaacctggtaccttgtagcagccttaaaggggtgcccgaaaaatctcaggaa
tggatttacactcaggttcagcagataagccagcagggtctgtgtctgtccgtgcacacc
ttgtttccagggacacaggtggtcctcttgccctgcaaagaaggagatgggaagcagcga
tggagtaaagtgggctctcacatcgaacatatggcctcccacttctgcctggatacggaa
atcatcggcgacgcggatgagaacaaccgcgagatcgtaatcaacccttgcgagaccact
gccatcagtcaacgctgggagatggtccttcaaggcttccactga

DBGET integrated database retrieval system