KEGG   Nanorana parkeri: 108797711Help
Entry
108797711         CDS       T04897                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1-like
Organism
npr  Nanorana parkeri
Pathway
npr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:npr00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108797711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2 WDCP DUF1664
Motif
Other DBs
NCBI-GeneID: 108797711
NCBI-ProteinID: XP_018424865
LinkDB All DBs
Position
Unknown
AA seq 654 aa AA seqDB search
MSSSPSNSPQRSCKVGILTSKRNLQNKRNTLEMNENLNTQYEGFNSNGQQGQERATSTFE
LKHDVMINTGSPRPGINLDPRMSIYSTRRPLLSRTHLQGRVYNFLERPTGWKCFVYHFTV
FLIVLICLIFSVLSTIKQYSNLATETLFWMEIVLVVFFGAEYVVRLWSAGCRSKYVGVWG
RFRFARKPISVIDLIVVVASIIVLCVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWR
LLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDGSGEYQFGSYADALWWGVVT
VTTIGYGDKVPQTWIGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIP
AAASLIQTAWRCYAAENPDSVTWKMYIRKPSRSQQIMSPSPKPKKIVMVKRKKMRTEKEE
GSTEKMLNIPHITYDHVADDRKNDYSVEAYENTVTKKSFGLLDTGTGPFIRTSSFADDVD
MEADTLLTPITHISQLREHHRAAIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHL
NLMVRIKELQRRLDQSLGKPSLFLSVSDKVKDRGTNTIGSRLNRVEDKVTQMDHKLNLIS
DMLQHLVSNQQGGQPTSRSPHRSNSLNNANNLSSSTLPTYEQLTVPRGAQDNNS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatcaccttctaattcaccacaaagaagctgtaaagttggaatcttaacttcc
aagcggaacctccaaaacaaacggaacactttggagatgaatgaaaatctgaacacgcaa
tatgagggctttaacagcaacggacagcaaggtcaagagcgggccacctccacatttgaa
ctgaaacacgacgtaatgattaacacgggatccccccggccgggcatcaatctagacccc
cgaatgtccatctacagcaccaggagacctttgctttcaaggacccatctacaaggcaga
gtttataactttttagaaaggccaacgggatggaagtgttttgtgtatcactttacagta
tttcttatagtgctgatatgccttattttcagtgtgctttctacaataaagcagtattcc
aatttggccacagaaaccttattttggatggaaattgttctggtggtattttttggagca
gaatatgttgtacgattgtggtctgcaggttgccgaagcaaatatgttggggtttgggga
aggtttcgctttgctaggaaacccatttctgttatagatttaatagtagttgtagcctct
atcatagtcctttgcgtgggatcaaatggacaagtatttgcaacatcagcaattagaggg
atccgatttctgcagatcctacgtatgttacatgttgatcggcaaggtggtacatggaga
ttgcttggatcggttgtctttatacatagacaggaactaataaccacactgtacattgga
ttcctgggcttaatcttttcttcatattttgtataccttgctgaaaaggatgctgttgac
ggttcaggagaataccagtttggtagctatgcggacgccctgtggtggggagtagttacc
gttacaaccatcggttatggagacaaagttcctcagacgtggattgggaaaaccatagcc
tcttgtttctccgtctttgcaatctctttctttgcattgccagcgggtatccttggctct
ggttttgccttaaaagtacagcaaaagcagcgtcagaagcactttaaccgccagattcca
gctgcagcatctctcatacagacagcatggaggtgttatgctgcagaaaacccagactct
gtaacatggaaaatgtacatcaggaagccctcacggagccaacaaatcatgtcacctagc
cccaaacccaagaaaatagtaatggttaaaaggaagaaaatgcgcacagaaaaagaggag
ggctccacagaaaaaatgttaaacattcctcatattacatacgatcatgtggcagacgat
cgaaaaaatgactactcagtggaagcctatgagaatacagtaacaaaaaagagctttggg
ctgctggataccggcactggacctttcatcagaacaagcagttttgcagatgatgtagac
atggaagcagacactttactgaccccaataactcatatctctcagctacgggaacaccat
cgagcagcaataaaagtcatccgtagaatgcagtactttgtggccaagaaaaaatttcag
caagccaggaaaccctatgatgtacgggacgtcattgaacagtactcacaaggtcatctt
aatctgatggtcaggatcaaggagctacagagaaggcttgaccagtcattggggaagccc
tcattgtttctctctgtgtcagataaagtgaaagatcgcggtactaatactattggatca
agattaaaccgtgtagaagataaggtaacccagatggaccataaactgaatctcatatct
gacatgcttcagcatctcgtttccaaccaacagggaggtcaaccaacaagccgatcacct
cacagaagcaattccctaaataatgcaaataacctgtcaagcagcacccttcccacctat
gagcagttaactgtgccaagaggagcccaggataataattcttga

DBGET integrated database retrieval system