KEGG   Nanorana parkeri: 108797884Help
Entry
108797884         CDS       T04897                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
npr  Nanorana parkeri
Pathway
npr00250  Alanine, aspartate and glutamate metabolism
npr00410  beta-Alanine metabolism
npr00430  Taurine and hypotaurine metabolism
npr00650  Butanoate metabolism
npr01100  Metabolic pathways
Module
npr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:npr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    108797884 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108797884 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108797884 (GAD1)
   00430 Taurine and hypotaurine metabolism
    108797884 (GAD1)
Enzymes [BR:npr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108797884 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS OKR_DC_1 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 108797884
NCBI-ProteinID: XP_018425082
LinkDB All DBs
Position
Unknown
AA seq 590 aa AA seqDB search
MASSSPPSSSANQDTNPTNLRPTTYDTWCGVAHGCTKKLGLKICGFLQRNNSLEDKSRIV
SSFKERQSSKNLLVCENIEKESRFRHTETDFSNLYARDLLPAKNGEESTMQFLLEVVDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGIEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDMIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSGKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLIIFTSEQSHYSMKKAGAALGFG
TENVILVKCNERGKLIPADLEAKILETKQKGHVPLYVNATAGTTVYGAFDPIHEIADLCE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERADSVTWNPHKMMGALLQCSAILLKEKGIL
QGCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQQINKCL
ELSEYLYQKVSNREDFEMVFKGEPEHTNVCFWYIPPSLQGMPHCEERQEKLHKVAPKIKA
LMMESGTTMVGYQPQGDKANFFRMVISNPAATKSDIDFLVDEIERLGQEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcttctcctccttcgtctagtgccaaccaagacacgaacccaaccaatcta
agacctacaacttatgacacttggtgtggggtggctcacgggtgtacgaaaaagctggga
ctaaagatttgcggcttcctgcagaggaacaacagtttggaggacaagagcagaattgta
agttccttcaaggagagacagtcctccaagaatctcctggtctgtgagaacattgagaag
gaatcaaggttccgacacaccgagacagatttctccaacttatatgccagagatttactg
cctgccaaaaatggagaggaatccaccatgcagttcctcctggaggtggttgacattctc
ttgaattatgtgaggaaaaccttcgacagatccactaaagtcctggatttccaccaccct
caccagctcctggaagggattgaaggctttaatctggaactgtcagacaaccctgagtcc
ctagagcaaatcctggtggactgcagggacactctgaagtatggagtacgaacaggtcac
ccacgttttttcaatcagctttcaactggactggacatgattggtttggccggagaatgg
ctgacctcaactgcaaatacaaatatgtttacctatgaaattgctccagtgttcgtcctg
atggaacaaataacactaaggaaaatgagagaaataattggctggtctggaaaggatgga
gatggcattttttccccaggaggtgcaatatccaacatgtacagtatcatggctgcccgc
tacaaatacttcccagaagtgaaaaccaaaggaatggctgctgtccccaaactaatcatc
tttacctcagaacagagtcactactctatgaagaaagctggagctgcactaggattcggg
acagagaatgtcatcctggtgaaatgcaatgagagaggaaagctcattcctgctgacttg
gaggccaaaatccttgaaacgaaacaaaagggacatgtcccactttatgtcaatgctact
gctgggaccacagtttacggagcatttgacccgatacatgaaattgcagatttatgtgag
aagtacaacctttggcttcatgtggatgctgcatggggaggaggactactcatgtctagg
aagcatcgccacaaattaaatggaatagaaagagctgactctgtcacctggaatcctcac
aaaatgatgggtgcattacttcaatgttctgcaatcctcctaaaggaaaagggaattctt
caaggatgcaatcagatgtgcgcagggtatctcttccaacaagacaagcagtatgacata
tcatatgacacaggagataaagcaatacagtgcggtcgccatgtagatatatttaaattc
tggctcatgtggaaagcaaagggcactgtaggatttgaacaacagatcaacaaatgttta
gagctctcagaatacttataccaaaaggtcagcaaccgggaagactttgagatggtcttc
aaaggagagcctgagcacacaaacgtttgcttctggtatatccctccaagtcttcaggga
atgcctcattgtgaagagaggcaagaaaaattacacaaggttgctccaaagataaaagcc
ctcatgatggaatcgggaacaacaatggttggataccaaccacaaggggacaaagccaac
ttcttccggatggtcatctcaaacccagcagccaccaaatctgacatcgattttttggtg
gatgaaattgagagacttgggcaggaattgtga

DBGET integrated database retrieval system