KEGG   Nanorana parkeri: 108797981Help
Entry
108797981         CDS       T04897                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
npr  Nanorana parkeri
Pathway
npr00010  Glycolysis / Gluconeogenesis
npr00030  Pentose phosphate pathway
npr00051  Fructose and mannose metabolism
npr00052  Galactose metabolism
npr01100  Metabolic pathways
npr01200  Carbon metabolism
npr01230  Biosynthesis of amino acids
npr03018  RNA degradation
Module
npr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108797981 (PFKP)
   00030 Pentose phosphate pathway
    108797981 (PFKP)
   00051 Fructose and mannose metabolism
    108797981 (PFKP)
   00052 Galactose metabolism
    108797981 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    108797981 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:npr01009]
    108797981 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:npr03019]
    108797981 (PFKP)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     108797981 (PFKP)
Protein phosphatases and associated proteins [BR:npr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108797981 (PFKP)
Messenger RNA biogenesis [BR:npr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     108797981 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 108797981
NCBI-ProteinID: XP_018425171
LinkDB All DBs
Position
Unknown
AA seq 793 aa AA seqDB search
MEQRESKAGRNGLRKFFENLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVEAKVYFV
YEGYQGMVDGGANIVEVSWESVSSILQVGGTVIGSARCKAFRNREGRLQAAYNLVQRGIT
NLCVIGGDGSLTGANLFREEWSGLLDELVKNGKIEASASQEYAHLNIVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIP
ECPPEEGWEDLMCTKLSENRARKKRLNIIIVSEGAIDCHNTAISSERIKELVVSRLGFDT
RVTILGHVQRGGTPSAFDRILASRMGVECVLALLEATPETPACVVSLCGNQAVRLPLMEC
VQMTQEVQKAMDDRRFADAVRLRGRSFENNLNTYKLLSHKKNISELPKSNFNVAVLNVGA
PAAGMNAAVRSAVRVGITEGHKMFAVSDGFEGFAKGQVKEIKWGDVGGWTGQGGSLLGTK
RTLPAKYFDQIAEQIRANSISALLVIGGFEAYLGLMELTVARGKYDEFCIPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYVFEEQFDIRELQANVEHLTEKMKTTIQRGLVLRNENCNENYTTDFIYQLYSEEGRG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAIQWISRKLKECYRKGRVFANTEDSVCL
LGMRRRALDFQPVMQLRDETDFKHRIPKEQWWLKLRPLMKILAKYKTSYDISDAGKLEHV
HVRRPKECEVGAI
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggagcagagggagagcaaagctggaagaaacggtctaagaaagttctttgaaaacctg
tccggggctggtaaagcgataggagtcctgaccagcggaggggatgcccaaggtatgaat
gcagctgtccgtgctgttgttcgcatgggaatctacgtagaagccaaagtatactttgtc
tatgagggttatcagggtatggtcgatggtggagccaacattgtagaggtatcgtgggag
agcgtgtcaagcatcctgcaagtgggtggtacagtcattggaagtgcccgctgcaaagca
ttccgcaaccgtgaagggcgtttgcaggcagcttacaacctagttcaacgtggtatcaca
aatctctgcgttatcggaggagatggcagtttaactggcgctaatcttttccgagaggag
tggagcggacttcttgatgaattagtaaaaaatggaaaaattgaagcttcagcttctcag
gaatatgcccatctgaatattgtcggaatggtgggctccatcgataatgatttctgtgga
actgacatgacaatcggaaccgactcagccctgcacagaattattgaggtggtggatgcc
atcatgactactgcacagagccaccaaaggacctttgttttggaagtcatggggcggcac
tgtgggtacctggccttggtcagtgccttagcttgtggagctgactgggtcttcatccct
gaatgtcctccagaggaaggatgggaagacttaatgtgcactaaactttctgagaaccgt
gcaagaaagaaaaggctcaacatcattatcgtctcagaaggagccatcgattgtcacaac
actgcaatcagttcagagaggatcaaagagcttgtggtttcacggcttgggtttgacaca
cgagtgacaatattgggtcacgtccagagaggaggaaccccgtcagcctttgaccgaata
ttggccagtaggatgggagtggaatgtgtcctagccttactggaagccactccagaaacc
cctgcctgtgtggtatctttatgtggaaaccaagccgtgcgcctgcctctaatggaatgt
gtacagatgacccaagaagtacagaaggcaatggatgacaggcggtttgcagatgctgta
aggttgcgtggaaggagttttgagaacaatctaaacacgtacaagctcctttcacataag
aagaatatatctgaacttccaaagagtaactttaatgtggctgtcctgaacgtgggggct
ccagccgctggaatgaatgctgctgtgaggtctgcagtgagagtcggcattacagaagga
cacaagatgtttgcagtcagtgatggctttgaaggattcgctaagggtcaggttaaagag
ataaaatggggagatgttggtggctggactggtcaaggtggatctcttttgggaaccaaa
agaactcttcccgctaaatattttgaccaaattgctgaacagatacgagctaatagcatc
agtgctctgctcgtcatcggagggtttgaggcctacttgggactgatggagctgactgtt
gctcgagggaaatatgatgagttctgtatccctatggttatggtgcccgccactgtctcc
aacaatgtccccggttcagatttcagcattggcgcagatactgctctgaacactataaca
gatacctgtgatcgcattaaacaatctgccagtggaacaaagaggcgcgtcttcatcatt
gaaacaatgggtggatattgtggatacctggccaacatgggtggccttgctgcaggtgct
gatgccgcttatgtcttcgaggagcaatttgacatacgggagctccaggcaaatgtggaa
catttgactgagaagatgaagacaaccatccagagaggccttgtactaaggaatgaaaac
tgcaatgagaactacaccacggatttcatctaccagttgtactccgaggaaggaagaggt
gtctttgactgcaggaagaatgtactcggacacatgcaacagggaggagcgccatcacca
tttgacaggaacttcgggacaaagatttcagccaaagccattcagtggatttcccggaaa
cttaaagaatgctacagaaaaggcagagtatttgctaacacggaggacagcgtctgtctg
ctaggaatgcgcagacgtgctctcgacttccagccagttatgcagctgagggatgaaact
gacttcaaacacagaattccaaaggagcagtggtggctgaagctgagaccattgatgaag
atcctggccaagtacaagaccagctacgacatttcagacgctggaaagctagaacacgtt
cacgttagacgaccaaaagaatgtgaagtgggggccatataa

DBGET integrated database retrieval system