KEGG   Nanorana parkeri: 108798233Help
Entry
108798233         CDS       T04897                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 3A-like
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:npr04040]
    108798233
Ion channels [BR:npr04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   108798233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 108798233
NCBI-ProteinID: XP_018425468
LinkDB All DBs
Position
Unknown
AA seq 471 aa AA seqDB search
MCLFTSGPAKRISDMFAFPGPGWSQKNNGSGLIKPALIRLSEHLMDGYKKGIRPVYDWRH
TTVVNIDLIVFAILGIEEKSQVLRSYLWLLQSWVDEFLTWDPTKFDKVTQISIPRELIWI
PDIMIVEFVDTTLSLDTPYVYVDYQGRINNNRPLVVATACSLNTHYFPFDIQRCSISLTS
WLHTNKDVNVSFVEKNHRLNQFKNNYLNDGEWDLINVFYKYRLLKDYEKNIGEYTLVIRR
RPLFYTISLIMPSIFLMVINVAGFYLPPESGERISFKITLILGYSVFLIIVADTLPATGT
PLIGIYYLMCMGFLMASLIESIFIVRMVHQHNVHAEVPKWLKRLVLEKLISVLGIQNKMF
EELRKNPPHKPQGMETDGTGEIGNFNVVHPRESPMPTNAVLPVAENDGLLSKILKEIVTI
REHVRNNDETITKEWLQVAYILDMFIFRAYLFAIITFAVSLVAIWSITYKV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctgtttacatcaggtccagcaaaacggatctctgatatgtttgcttttcctgga
cctggctggtctcaaaaaaacaatggctcaggcctaataaagccggcactcataagactt
tcagaacacttgatggatggatacaagaaaggaataaggccagtttatgactggagacac
actacagtagtgaacattgatttgattgtttttgccattttgggaatagaggaaaaaagc
caagtgttgagaagttacctctggcttctacagtcctgggttgatgaatttctcacctgg
gatccaacaaaatttgacaaagtcactcaaatttccattcctagagaactcatctggatc
ccagatataatgatcgtggagtttgtggacacaacattgtctttagatactccatatgtg
tatgttgattaccaaggaagaataaataacaacagaccccttgttgtagcaactgcctgc
agcctcaatacacactatttcccattcgatatacaacggtgctccatttccttaaccagc
tggcttcacacaaataaagatgtaaatgtgtcttttgtggaaaaaaaccacaggctgaat
caattcaagaacaattacttgaatgacggagaatgggatcttatcaatgttttctataaa
tatagacttctcaaggattatgaaaaaaacattggagagtatactctagttatcagaaga
agacctctcttttataccattagtctaattatgcccagtatatttctcatggtgataaat
gttgctggattctacctcccaccagagagtggcgaaaggatatcatttaagatcacactt
attcttggttactctgtctttctcatcattgttgctgatacattacctgcaactggaact
ccgttaataggtatctactacttaatgtgcatgggatttcttatggccagtttaatagag
agcatctttatagtgcggatggtccaccagcacaatgttcatgcagaagttcccaaatgg
cttaaacgtttggttctggagaaattaatttctgttctgggtatccaaaacaaaatgttt
gaagaactccggaaaaatccccctcataaacctcagggcatggagacagatggtactggt
gaaataggaaatttcaacgttgtccatccaagagaaagcccaatgcccactaatgcagtc
ttgccagtcgcagaaaatgatggtctcttatccaagattctaaaagaaattgtaaccatc
agggagcatgtaagaaataatgatgaaactatcacaaaagaatggctgcaagttgcttac
atactagatatgtttatcttccgtgcttatctctttgcaataatcacgtttgctgtttca
ttggttgctatttggtccattacgtataaggtgtga

DBGET integrated database retrieval system