KEGG   Nanorana parkeri: 108798706Help
Entry
108798706         CDS       T04897                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
npr  Nanorana parkeri
Pathway
npr00590  Arachidonic acid metabolism
npr01100  Metabolic pathways
npr04370  VEGF signaling pathway
npr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108798706 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108798706 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108798706 (PTGS2)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108798706 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 108798706
NCBI-ProteinID: XP_018425986
LinkDB All DBs
Position
Unknown
AA seq 603 aa AA seqDB search
MNILGILLCSLLASSLAASPCCSNPCQNRGVCMTIGSDRYECDCTRTGYYGENCITPEFL
TRLRVTLKPSPNTVHYILTHFKGIWNIINNISFLRDGIMRYVLTSRSHLIDSPPTYNSQY
AYKNWEAYSNISYYTRALPPVEEDCPTPMGVKGKKELPSVKLVVEKLLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDTKRGAAFTKALGHGVDLNHIYGESLDRQHKLRMKKNGKLKF
QIIDGEMYPPTVNDTGVEMLYPPHMPEHLRFAVGQEVFGLVPGLMMYSIIWLREHNRVCD
ILMQEHPEWDDERIYQTAKLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDAFKINGREYYYQQFLYNNSVILEHGISQMVESFNKQQAGRV
AGGRNFPAAISRVAMASVQQSREMRYQSLNEYRKRFTLKPYKSFEELTGEKELSAELEEL
YGDIDAVEFYPGLLVERPRPGAIFGETMVEIGAPFSLKGLMGNPICSPEYWKPSTFGGRV
GFDIVNSASLQKLICNNVKDCPSTSFNIFKSKVAEPGSINSSSNSALDDVNPTLLLKEHS
SEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctcggaattctcttgtgttccctgctggcttcttctcttgcagcaagccca
tgctgctctaatccatgtcagaacagaggggtatgcatgactattggctcagaccgctat
gagtgtgattgcacaaggacaggatactatggagaaaactgtatcacacctgaattttta
accaggctgagagttaccttaaagccttcgcccaatactgtgcactacatcttaactcac
ttcaaaggcatttggaatataatcaataatatctctttcctccgagatggaatcatgcgt
tatgtattaacatctcgctcccatctaattgacagtccccccacatacaacagccaatat
gcctacaaaaactgggaagcatattccaatatttcatactacactcgagcactgccacca
gtagaagaagattgcccaaccccaatgggtgtgaaaggaaagaaagaactgccaagtgtc
aaactggttgtagagaaattgttacttagaagaaagttcatccctgacccacagggaacc
aatatgatgtttgcattctttgcccaacactttacacaccaattctttaagactgacacc
aaaagaggagctgccttcactaaagcacttgggcatggggttgatttaaatcacatctat
ggggaatctttagatagacagcacaaactacgtatgaaaaagaatggaaaattaaaattt
cagattattgatggtgagatgtaccctccaacagtgaatgacacaggggttgaaatgctt
tacccaccacatatgccagaacatcttcgatttgcagttggacaggaggtttttggcctt
gtaccagggttgatgatgtattctatcatatggctgagggaacacaaccgcgtctgtgat
atactgatgcaggagcaccctgagtgggatgatgaacgtatataccagactgcaaaactt
attttgattggtgaaaccatcaaaattgtcattgaagattatgtgcagcacctgagtggt
tatcattttaaactgaaatttgacccagagttgttgttcaaccagagattccagtaccag
aatcgaattgctgctgagttcaacacactatatcattggcatcctctattgccagatgct
ttcaaaataaatggcagagagtactactatcagcagttcctgtataacaatagtgtgatc
ttggaacatggaatatcccagatggttgaatcatttaacaagcaacaggcaggaagggtg
gctggaggcagaaacttccctgcagcaatttccagagtggctatggcttctgtacaacaa
agccgagagatgagataccagtcactcaatgagtataggaagcggtttacattaaagccc
tataaatcttttgaagagctgacaggagaaaaggaattatctgcagaacttgaagaacta
tatggagacattgatgctgtagaattctacccaggtcttttggtggaacgaccccgtcct
ggggccatatttggagagaccatggttgaaattggtgctccgttttcattgaaaggcctt
atgggaaacccaatttgctctcctgaatactggaaacctagcacatttggcggaagggtg
ggctttgatattgtaaacagtgcctctttacaaaaacttatctgcaacaatgttaaagac
tgtccctctacttcatttaatatatttaaaagcaaggttgctgaacctggaagcataaac
tcaagttctaactctgcactggatgatgttaaccctactttactactaaaggaacactcc
tcagagctgtaa

DBGET integrated database retrieval system