KEGG   Nanorana parkeri: 108799254
Entry
108799254         CDS       T04897                                 

Gene name
PRDM6
Definition
(RefSeq) putative histone-lysine N-methyltransferase PRDM6
  KO
K20795  [histone H4]-lysine20 N-methyltransferase PRDM6 [EC:2.1.1.361]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108799254 (PRDM6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108799254 (PRDM6)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.361  [histone H4]-lysine20 N-methyltransferase
     108799254 (PRDM6)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108799254 (PRDM6)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 SET zf-C2H2_jaz zf-C2H2_11 zf-H2C2_5 zf-C2HC_2
Other DBs
NCBI-GeneID: 108799254
NCBI-ProteinID: XP_018426597
LinkDB
Position
Unknown
AA seq 545 aa
MLKPGEAAGSAFLKVDPVYLQHWQQLFPQTHVKAGVPNHVPLPEPPTESLRLRPASLSST
SSTSSTPTSAPSAPSSLAGITPIHTVIGPAPSLELPGPPRKDLVRPSCQEGASSRFQCTP
EELDYYLYGQQRMEIIPLSNPTSDPNNRCDMCADNRNGECPMHGPLHSLRRLVGTSSTAS
VAPPPEIPEWLRDLPREVCLCTSTVPGLAYGICAAQRIQQGTWIGPFQGVLLSPDKVQSG
AIRNTQHLWEIYDQDGTLQHFIDGGEPSKSSWMRYVRCARHCGEQNLTVVQYRSSIFYRA
CIDIPRGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSPVMEAMTRQDALQPFNKNGKL
PSSTLQRSIVFPQTPCNRNYSLLDKSGPLDTGFNQINAKNQRVLASPTSTSQLNSEFSDW
HLWKCGQCFKTFTQRILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFK
CGYCGRAFAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITESTE
SIEVD
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgctgaagcccggggaggctgctggatctgccttcctcaaggtggacccggtgtacctc
cagcactggcagcaactattcccccagactcatgtcaaggctggagttccgaaccatgtt
cctcttcctgagcctccaactgaaagcctccgcctgagaccagcctccctgtcctccacc
tcctctacttcctctaccccgacatcagcaccctctgccccctcatcactggccggaatc
actccaatacatacagtcataggaccagcacccagcctggagctgccaggccctccaagg
aaagacctggtgcgcccaagctgtcaggagggagcctctagccgcttccagtgcacccct
gaggagttggactattatctatatggccagcaaaggatggagatcattcctctgagcaac
cccaccagtgaccccaataacaggtgtgatatgtgcgcagataatcggaatggagaatgc
cccatgcatggacctctgcattcactgcgacggctagtgggtactagcagcactgcatct
gtagcacctcctcctgaaatccctgaatggttacgtgacctaccgcgggaggtgtgtctt
tgtaccagcactgtaccaggtctggcatatggcatctgtgcagctcaaagaattcagcag
ggcacgtggattgggccattccaaggggttcttttgtctccagataaggttcagtcagga
gcaatacgaaacacacaacacctctgggaaatatatgaccaagatgggacactccagcac
ttcattgatggaggagaacccagtaagtcaagctggatgaggtacgtccgatgtgccagg
cactgcggggagcagaatctcactgtcgttcaatacagatccagcatattctacagagct
tgtattgacattccccgtggcacagaactgctggtgtggtacaatgacagctacacgtcg
ttctttgggattccattgcagtgcattgctcaggatgaaaacttgaatgtcccatcacca
gttatggaagccatgaccaggcaagatgcactgcagcctttcaacaaaaatggcaagttg
ccttcttccacattgcaaaggtccatagttttcccacagactccatgcaacagaaactat
tctcttctggataaatctgggcctctcgatacaggatttaaccaaattaatgctaaaaac
cagcgagtgcttgccagtccaacctcaacaagccaactcaactcagaattcagtgactgg
catctttggaaatgtggacaatgctttaagacttttacccaacggattctactacagatg
catgtgtgcacccagaatccagacaggccttaccagtgtgggcactgttcccagtccttt
tcccagccatcggaattaaggaatcatgtcgtcacccactccagtgatcgacctttcaag
tgtggctactgtggcagggcatttgctggtgctaccacattaaacaaccacatccgtact
cacacaggggaaaaaccttttaaatgtgagaggtgcgagaggagcttcacacaagctaca
cagctgagtcgacatcagaggatgcccaatgaatgcaagccgataacggagagcacagaa
tcaattgaagtggattaa

DBGET integrated database retrieval system