KEGG   Nanorana parkeri: 108799511
Entry
108799511         CDS       T04897                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
npr  Nanorana parkeri
Pathway
npr04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108799511 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:npr04052]
    108799511 (EPO)
Cytokines and growth factors [BR:npr04052]
 Cytokines
  CSF and other factors
   108799511 (EPO)
SSDB
Motif
Pfam: EPO_TPO SLC3A2_N
Other DBs
NCBI-GeneID: 108799511
NCBI-ProteinID: XP_018426877
LinkDB
Position
Unknown
AA seq 287 aa
MRSSVERIGRVTQAAFRSEGELPCSPTGNAEVTSRPYHFRNAAGVPTGPIRVHRLSLRVL
LLDLLLTTPLLLDLLLLDASWSASGKLQERCRTIVVLLLEIGSDPSWKGTHARCAFCLSG
LLILLQMLLVNVKLVTPQPVCDRQFLDSFIRTAVDEDKVMNVPCVFPEDVIIPEPSINAE
WRKLQISQQRDEVQQGLSLLMTAVPKVTKFISECKLELSLQKFSSKVRTLKNILDRVNVK
TESEYPPREARTFPARTLQQFYGVYRNFLQGKYRTVIISICSRAQNR
NT seq 864 nt   +upstreamnt  +downstreamnt
atgcgttccagcgtggaacgcatcggccgcgtcacgcaggccgctttccgctcggagggg
gagcttccctgctctccaacggggaacgcggaagtgacgtcacggccgtatcacttccgg
aatgccgctggtgtgccgactggccctatccgtgtccacaggctcagcctgagggttctg
ctgcttgacttgctgctgacgaccccgctgctgctggatttattgttgctggatgccagt
tggagtgcgtcggggaagctgcaggagcgttgtcgaaccatcgttgtcctgttgttagag
atagggagcgatcccagctggaagggaactcatgcgcggtgtgcgttctgtctttcaggt
ttacttatcctgctacaaatgttgctggttaatgtgaagcttgttactcctcagccggtc
tgcgacagacaatttctggacagtttcatcagaaccgcggtggatgaggataaagtgatg
aatgttccgtgtgttttccccgaggacgtcatcataccagagccgagtattaacgcagaa
tggaggaagctgcagatatctcagcagagggatgaagttcagcagggactctctttactt
atgactgctgtcccgaaggttacaaagttcatctcggaatgtaaattggagctctcactt
cagaaattctccagcaaagtgcggacactgaagaacatcctggacagagtcaatgtaaag
accgaatcagaatatccgcctagagaagcaagaacgtttcccgcaaggactttacagcaa
ttctacggtgtttacaggaactttttacaagggaaatataggactgtcatcatttccatt
tgcagccgagctcagaacagatga

DBGET integrated database retrieval system