KEGG   Nanorana parkeri: 108799776
Entry
108799776         CDS       T04897                                 

Gene name
KMT2B
Definition
(RefSeq) histone-lysine N-methyltransferase 2B
  KO
K14959  [histone H3]-lysine4 N-trimethyltransferase MLL4 [EC:2.1.1.354]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108799776 (KMT2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:npr03000]
    108799776 (KMT2B)
   03036 Chromosome and associated proteins [BR:npr03036]
    108799776 (KMT2B)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     108799776 (KMT2B)
Transcription factors [BR:npr03000]
 Eukaryotic type
  Zinc finger
   CXXC CpG-binding proteins
    108799776 (KMT2B)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108799776 (KMT2B)
   HMT complexes
    MLL3/MLL4 complex
     108799776 (KMT2B)
SSDB
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2 Bromodomain
Other DBs
NCBI-GeneID: 108799776
NCBI-ProteinID: XP_018427197
LinkDB
Position
Unknown
AA seq 2788 aa
MKMAAAASAGPGASGSVRGRFPGRPWVGRSGNREEVVELKEEKSESAPLRLALRSNKGPN
SSPTSSAVFPFKEESPPMSNAKQASPTAATVKEECAALPKSMHGFTPDKIVRVHLTQLDP
SLYGINTSFLLTPKESVVASRNHLTLPSNPVKEQTRSTITSRRNKRRKGKGKRLTYRKAP
VRRQPKVAESVVFCQDVSSRDSPVALVEESPADEDTRVHIASYESEASKVAQANIALEGS
SKPSTSDADQPTGPSSPSSRADGKVEEQATTMEVEQEKSCLPLKRKGRRDRQVRKVKWKL
RAEPRQESEEEPRGKESENLEADIGQEKVEDERIPANVEPLPDNGESSEPRPEPVPVKEE
TPEKTLEDGPDLTPLPVEGHQQGDNFENSSLVEMPSEEVKVIDPLQPAEPLPETTVSASI
QGTAPISEPIDPVDTASSVSDQQPPPKQFGPLRKSKKAKRTCSLQTDRTAAQKLIAKVKE
AQSKAQSQLPAQPSKAVCPETTESVKPSVNARPSRVIKIPRRLIEEDLPNVTDAQVKRGL
SEPVGILAELEKQVLSDAPADPCFSLFNEDDHLNMLPPASPRTDSTLTSSTPSSAASSPS
LPPAPAPSAPSESLRKNILRAPTFRWNSFNISAPEAQETASSSQPPKHLSSPEPSEHPVK
SSTLKTPSPSHLPSDPPPKPESKRSPLLRAPQFTPSEAHLKIYQSVSLQDNEANKASAVT
TGRKHLSDHSSATVAGASPDLSPGTSAKESPTVGRRANHLALPLFADTVSGGLQAPHTSQ
ISNQTVKLPEPVQSLNLKSERGLRPNEADASVKPLKMEAMTLCPGEVALKSQFQSQSMSS
QGVLTFPPTELSLSGTDKKVINLLEKAKIQLFKIDKQKSADQGQDSPVQGPRIKHVCRHP
AVALGKPRAMIPEDIPRLSALPLCEREAVVPAAAAAAEEAPEEESSASEPEPTTVTRQKP
VRQSSAPPPRRPRPTSRVRLRMARCGKCKGCNVMEDCGRCVNCKDKTKFGGPNTKKQCCV
YRRCERIEARRQQRIAQKGRKPIRHLPTRESSSESDDFFAEVCRNDDTEASERLEPGVPS
QRKSTRRCVRQRPCYDLFPDSEDSDFDPSPSAPRRKQRRESDLLPQDSEEQNKPRRVPQQ
PVILRARSGQEQDSTLNGTSTKIKSSDGTHRLRVDFKEDCDLQNVWMMGGLSILTSFPVT
PTHVCLLCASRGHHQFLYCQVCCEPFHTFCLEESERPLPEQEDSWCCQRCKFCNVCGHKG
KAKKPLLECELCQTNYHIYCLGPNYPVKVPRSGKGWLCSSCVRCKSCGASPAVDADLELT
EGGNLCTACSTLYNKGSFCPICSRCYEENDYDSKMIQCAKCDKWVHSKCEGLSDEGYEIL
SNLPESVVYTCPPCLGEGGTIWREAMLSELHAGFHEIIQSLLSSELSSPLRHCAQCSNAG
AEGKCLHSPCDLQSLEKLLEDGHYNAIACFNDDVVRIIQQNMENGVLNEGGEALKALYIK
LMEKSFSWFSVEDSKYWEKDDKSLATGVLPNAIMPPYSDHSYALWQDREDGSHPRNGEVV
QPILPRKIKKEEDESGGVPEKDNRQCVLCLKYGDDGPKDAGRLLYIGQNEWTHINCAIWS
AEVFEENDGSLRNVHAAVARGRQMRCEFCLKSGATVGCCLSTCQSNFHFMCARARNCTFQ
DDKKVFCQKHGKLLDGTKVDTDSFDVLRRVYVDFEGVSFRRKFLQGLEPENINMMIGAMK
IDCLGMLTDLSVSEGKIYPVGYQCSRLYWSTLDARRRCWYKCRVVEHRPKEGDISSDGED
SQCVNRTIAHSSPGLVPESTEAVPASTPPPPEAPSLSHRPPPEPITTATAPRSFSGARMK
MPNFSPSRKPLGGFSRPLPSPGSPSSPSRSHHILTVSDPEVTPLRRTRRPPGPPPPRVTR
QSSTRVSRDSASPPPSPTSSPLARHSSSEAPSQLLTDIELMSSLDTELVTGPLPCGAQLL
VGMEAPAAESDGASSSEEEPGGEYYGLTRTVVSNEPFSPLMSTTPPGRIEQLDGIHDSTD
SEDPPQSHNGPMTTGKTPTHLPSEIVDFVLKSGEVTETDHTTQQVRVPSPIATTSPITQN
GNSVVALSNGTDCVSYQSSQGPPPLRDPPQVQRVCRPLVPITPNGPSCPSDPASVTASKL
ASKFILVNKTTGQIIAVQDDSIDFRGQLRTLQEGANSDPHSLTKPTILRPNCKVAPRPIN
KTRIACLPPTTSSVLSSASPAPTPSIGTVFLQATPSGSPSITLRVLPMLNVVQGTGQLTL
GAPTVMAPTIAGLPQPCLLQGLPVNTGLLSVAPTAVQTQVPPQMQAPLMHHSPPKNHKIQ
PATKRPCPVVNNLSPKKKHKLDMSDKLEHLDPHLITQSVAINLNCASETVTTTRYGQKSK
RNRMKTLIPKEFVNLNSLDANVPTLDSEIHLDLTVDVKTEDPPFESPVESPGSEPPAGFS
PNFEDFEERFLAEKENTLSKKGRPHLRFEIISEDGFYTHSYSAEGAWKAVVEKVQEARSA
ARLRQLSFSAGLSGARMLGVQHDAVLFLLEQLLGAERCRGYNFHFHPQEVDEEVLLVNPT
GCARSEYYVRKCTFDMFNFLASRHRTLPEMCAYEEEEEEVQLKSTRRATSLDLPMAMRFR
HLKKTSKEAVGVYRSSIHGRGLFCKRNIDVGEMVIEYSGIVIRAVLTDKREKFYDSKGIG
CYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVIHVEGQKHIVIFALRSIYRGEELT
YDYKFPIEDPSNKLSCNCGAKKCRRFLN
NT seq 8367 nt   +upstreamnt  +downstreamnt
atgaagatggcggctgcggcctcggcgggtcccggagcctcgggctcggttcggggccgc
tttccgggccggccgtgggtagggagaagcgggaacagggaagaggttgtggaattaaaa
gaagaaaaatccgaaagcgctccgctccgcctggctttgagatcgaataaaggtccgaat
tcatctccgacctcttctgcggttttcccctttaaagaagagagcccgcccatgtcaaac
gcgaagcaagcgagccctactgcagccactgttaaggaagagtgcgcggcgctgcctaaa
tctatgcatggcttcacccccgacaagattgttcgagttcacctcacccaactggaccct
tcattgtatggcatcaatacgtcatttttacttactccaaaagagtctgtggtagcctcc
cgcaaccacctcactctcccctccaatcccgtcaaggaacagacccgctctactattact
tcaaggagaaataaacgtcggaaggggaaaggcaagagattaacgtataggaaagctccc
gtgaggcgtcagcccaaagtagcagaatctgtggttttctgccaggatgtctcctcaagg
gacagtccggttgctcttgttgaagagagccccgccgatgaagataccagagtccatata
gcaagttatgaaagcgaagcttccaaggtagcccaagccaacatagctcttgaaggctct
tctaaaccttccacttctgatgccgaccaaccaactggaccgagttctccttcttctcga
gccgacggaaaggttgaagaacaagccaccacgatggaagttgaacaagagaagtcttgt
cttcctcttaagagaaaggggcgacgagatagacaggttcggaaagtgaaatggaagctg
agagcagaacccaggcaagagagtgaagaagaacccaggggcaaggaaagcgagaatctt
gaagctgatattggtcaggagaaggttgaagatgaaagaataccggccaatgtagaacct
ttaccagacaatggagagtcttctgaaccaagaccagagccggtgcctgtaaaggaagaa
actcctgagaagactttagaagatggtccagatttgaccccattacctgttgaaggacac
cagcaaggagataactttgagaacagttcattagtggagatgccttcggaagaggtgaaa
gtaatcgaccccttgcagccagcagaacctctaccggaaacgacagtctctgcttcgatt
cagggaacggcaccaataagcgagcccatcgatccggtggataccgcctcgtccgtgtct
gaccagcagcctccaccaaaacagtttggccctctaaggaagagcaagaaagccaaacgg
acttgttctctgcaaacggaccgcacagctgctcagaagcttatagccaaggtgaaggaa
gcccagagcaaagcccagtcacaactcccagctcagccttccaaagcggtttgccccgag
accaccgagtcggtcaagccctctgtgaatgcacgtccttcccgcgtgattaaaattcct
cgaaggttaattgaagaagacctgccaaatgtcaccgacgcgcaggtcaagaggggcctg
tcggagccagtcggtattttggccgagctggagaagcaggtcctttccgacgcgcctgct
gatccgtgttttagtctttttaatgaagatgatcacctcaacatgctacctccagcatct
cctcgaacggactccacgctgacgtcctccacgccttcctctgcggcttcctcgccctct
cttccgcccgctccagctccctctgcaccttctgaaagtttgcgcaagaacatcctgcga
gcaccgacgttccgctggaactcctttaatatttctgctccagaagcgcaagaaactgca
agttcttctcagcctcctaaacacctgtcctcacccgaaccttcggagcatcctgtgaaa
tccagcacccttaagacaccctcaccttcccatctcccttctgacccacctcccaagccc
gagtccaagcgctctccactccttcgtgcgccgcagttcacccccagcgaagcgcacttg
aaaatctaccagtctgtctcccttcaggacaacgaggccaataaggcttccgctgttaca
acaggtaggaaacacctgtccgaccatagttcagccacggtggccggcgcttcaccagat
ctctcgccgggcacttccgctaaagagtcaccaactgtaggaagaagggcaaaccatttg
gcgttacctctgtttgctgacactgtttctggaggcttgcaggctcctcacacatctcaa
atctccaatcaaactgtaaagcttcctgagccagtccagtccctaaacttgaagtcggag
cgcggattacgaccaaatgaggcggatgcttccgtgaaacctctcaaaatggaggccatg
actttgtgccccggagaagttgcattgaagtcccagttccagtctcagtccatgagctcg
cagggcgtcctgactttccctcctactgaactctccctttccggcacagacaagaaagtc
atcaacctcttggagaaggccaagatacagctgtttaagattgacaagcagaagagtgct
gatcaggggcaggattccccagtgcaagggccgcggattaaacacgtgtgccgccatcct
gctgtcgctttagggaagccacgcgctatgattccggaggacatccccaggctgagtgcc
ctgccgctgtgcgagagagaggccgtggtgccagcagcagccgcagctgcagaagaagct
cctgaagaagagtcgtcggcctcagagccagagcccaccacggtcacccggcagaaacct
gtcaggcagtcgtcggcaccacctccccgccggcctcgaccaacatccagggtgaggctg
cggatggccagatgcggcaagtgcaaaggctgcaacgtgatggaggactgcggccgatgc
gtaaactgcaaggacaagacaaagtttggcggtcccaacacgaagaaacaatgttgcgta
taccggagatgtgagcggatagaagcccgcagacagcagaggatagcgcagaaaggccga
aagccaatccgacacctcccgacgcgagagagcagctccgaatcggacgacttttttgcc
gaggtctgccgaaacgacgacacggaagcttccgagcgactagaacccggcgttccgtcc
cagcgcaaatctacccgccgctgtgtgaggcaacgcccatgctacgacctcttccccgac
tccgaggattctgacttcgatccgagtccgagcgccccccgcaggaaacagcggcgagag
tccgatttacttcctcaggactcggaggagcagaataagccacgcagagtaccccagcag
cccgtgatcctccgcgccaggtctggccaggagcaggactcaaccttgaatggcacatca
accaaaatcaaatcttccgacggaacccaccgtctacgcgtcgatttcaaggaggactgc
gacctgcagaacgtgtggatgatgggggggctcagtatcttgacgtctttccccgtaaca
ccgactcacgtgtgcctgctctgcgccagccgcggacatcatcagttcttgtactgtcag
gtgtgctgcgagcccttccacacgttctgtttggaggagtccgagaggcctttgcctgag
caggaggacagctggtgctgccagcgctgcaagttctgcaacgtctgcggacacaagggg
aaagccaaaaagcctctgctggagtgcgaactttgccagacaaactatcacatttattgc
ctcggaccaaattatcccgttaaggtgccacgcagtgggaaaggctggttgtgttcctcc
tgcgttcgctgtaaaagctgcggcgccagtcccgcagtggacgctgaccttgagctgacg
gaagggggaaacctatgtacagcttgctccaccctatacaataaagggagcttctgtccc
atctgcagtcgctgctatgaggagaacgactacgacagcaagatgatccagtgcgccaag
tgcgataagtgggtgcactcaaagtgcgaggggctctctgatgaggggtatgagatcctc
tccaacttacccgagagcgtggtgtatacctgcccgccgtgtttgggtgagggcggcacc
atatggagagaggccatgctctcggaactgcacgctggttttcatgaaattatacaaagt
cttctgagctctgaactttcctcgcctctccggcactgtgcacagtgttcgaatgcgggg
gccgaaggaaaatgtctccactctccctgcgatttgcagtctctggagaaacttctggag
gatggacactacaacgccatagcctgcttcaatgacgacgtggtgcggatcattcagcag
aatatggagaacggggtattgaatgaaggtggcgaagctctgaaggcattgtatatcaag
ctcatggagaaatcttttagctggttcagcgttgaagactccaaatattgggagaaggat
gacaagtctttggccactggagtactccctaatgccattatgccgccatattctgatcac
tcgtacgccctgtggcaggatagagaagacggcagtcatccgcgcaatggggaagttgtg
caacccatactgccacggaaaatcaagaaagaagaggacgagtcggggggtgtgccggag
aaggacaatcggcagtgtgtgctgtgtctaaaatatggagacgatggaccaaaggatgct
gggaggctgctctatatcggacagaatgaatggacgcacatcaactgcgctatctggtca
gcggaggtgtttgaggagaatgacggctccctcagaaacgtgcacgctgcggttgctcga
gggcgacagatgcgttgcgagttctgtctgaagtccggagccaccgtgggctgctgcttg
tccacctgccagagtaacttccatttcatgtgcgctcgggcccgcaattgtaccttccag
gatgacaagaaggtcttctgccagaaacacggcaaactcttggacgggacgaaggtggac
acggactcttttgacgtgctccgcagggtctacgtggacttcgagggcgtcagcttcaga
cgtaaatttctgcagggcctggagccggagaatattaacatgatgattggtgctatgaag
atagactgtctgggtatgctgacagatctctccgtatctgaagggaagatataccccgtt
gggtatcagtgttcacgtttatactggagcaccctggacgcccgtcgccgctgctggtac
aaatgcagggtcgtcgagcatcgcccaaaagagggcgacatttcatctgacggagaggac
tctcaatgcgtcaacaggacaattgcccacagcagtcctggacttgtcccagaaagcaca
gaagccgttcctgcctccacccctccacctccagaagccccttcactttcccatcggccg
cctcctgagcccatcactactgctactgccccccgctctttctcaggtgctaggatgaaa
atgccaaacttttctccttcccgaaaacctcttggtggattttctcgcccgcttccttct
ccaggaagtccatcgtccccttctcggtctcatcacatcctgactgtaagcgatcccgaa
gttacacctctcaggagaacccggagaccgccggggccaccaccgcctcgagtcacccgt
cagtcttcaactcgggtttcccgggattctgcaagccctccaccttccccaacttcttca
cctctcgcgcggcattcttcttctgaggcgccgtcacagctcctgaccgacatagagctg
atgtcctccttagacactgaactggtcacaggccctttgccgtgcggtgctcaacttttg
gtgggtatggaggcaccagccgccgagtcggatggagcaagcagttcggaggaggagccc
ggaggggagtattatgggttgacacggacggtggtatctaatgaacctttcagtcccctg
atgtccaccactccgcccggtcgaatcgaacagctggatgggatccacgacagcactgat
agcgaggacccgccacagagccacaacggccccatgaccaccggaaaaacgccgacccac
ctgccttctgaaattgttgactttgtcttaaaaagtggcgaggtcacagagacggaccac
accacccagcaggtgcgggtgccgtctcctatagccaccacctctcccatcacgcagaat
gggaactccgttgtcgcactttccaatggcacagattgtgtaagctaccagtcctctcaa
ggacctcctccactcagggacccacctcaagtgcaaagggtgtgtcgccccctcgttccc
ataacccccaatggaccttcctgcccttctgatccagcatctgtgacagccagcaaactt
gcctcaaagtttatattggtgaacaagacgacgggtcagatcattgctgttcaagatgac
agtatagactttagagggcaacttaggacgctgcaggaaggggcaaattctgaccctcat
tctctcaccaagcccaccatattaaggcctaattgcaaggtcgccccaagacccatcaac
aaaactcggatcgcttgtcttcctccaactacttcctctgttttgtcttctgcttcccct
gctcctactccgagcataggcactgttttccttcaggcaactccctccggtagcccatcg
attacactacgtgtgctgccgatgctcaacgtggtgcaaggtactgggcagctgactttg
ggggctccgacggtaatggcccccactatcgctggtctcccacaaccctgtcttctgcag
ggcctgcctgtcaacacggggctcctgagcgttgctcccactgcagtccagacccaggtg
cctccacaaatgcaagctcccctgatgcatcacagcccccccaagaaccacaaaatccag
ccagccactaagaggccctgtcctgtagtcaacaacctctctcccaaaaagaaacacaag
ttggacatgtcggataaactggaacacttggacccgcacctgatcacacagtcagtagca
ataaacctcaactgcgcttctgagacggtgaccaccaccaggtatgggcaaaagtcaaaa
cggaatcggatgaaaactttaatacccaaagagtttgtgaacctcaactccctggatgca
aatgtgccaactttggatagcgagatccatttagatctgacagtggatgtgaaaacagag
gaccctcccttcgagtcacccgtagaatccccgggctcggagccccctgctggtttctct
cccaactttgaagactttgaggaacgttttctggcggagaaggagaacacgttgtccaag
aaaggcaggccgcacctgcgcttcgaaataatcagcgaggacggcttctacacgcattct
tatagtgctgaaggtgcatggaaggccgtagtggagaaggtacaagaggctcgaagtgcg
gcaagacttagacaactctccttctctgccggtctgagcggagcgcggatgttgggggtt
cagcacgacgcagtgcttttcctcctggaacagctcctcggtgccgagcgctgccgcggg
tacaacttccatttccacccccaggaggtcgatgaggaggtgttattagtcaacccaaca
ggttgcgctcgcagcgagtattatgtcaggaagtgcacatttgacatgttcaatttcctg
gcctctcggcaccgcacgctgccagagatgtgcgcctacgaggaggaggaagaggaagtg
cagctgaagtccacccgacgagcgaccagcttggaccttcccatggcaatgagattccgc
cacttgaagaagacctccaaagaggctgttggtgtgtacaggtcatctatccatggcagg
ggcctattctgcaagaggaacatagacgttggcgagatggtcatcgagtactcgggcatc
gttattagagctgtgctgactgacaagagggagaaattctatgacagcaagggaatcgga
tgttacatgttccgcatcgacgacttcgacgtggtcgacgccaccatgcacggcaacgcg
gcccgtttcatcaaccactcctgcgagcccaactgctactcccgggtcatccacgtggaa
ggccagaagcatatagtcatcttcgccctccgcagcatttaccgcggcgaggaactgacc
tacgactacaagttccccatcgaggaccccagcaacaagctgtcctgtaactgtggtgcc
aaaaagtgccgtcgtttcctgaactga

DBGET integrated database retrieval system