KEGG   Nanorana parkeri: 108800705Help
Entry
108800705         CDS       T04897                                 

Definition
(RefSeq) M-phase inducer phosphatase 1-like
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
npr  Nanorana parkeri
Pathway
npr04110  Cell cycle
npr04218  Cellular senescence
npr04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:npr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108800705
   04218 Cellular senescence
    108800705
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    108800705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:npr01009]
    108800705
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:npr03400]
    108800705
Enzymes [BR:npr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     108800705
Protein phosphatases and associated proteins [BR:npr01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    108800705
DNA repair and recombination proteins [BR:npr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    108800705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: M-inducer_phosp Rhodanese
Motif
Other DBs
NCBI-GeneID: 108800705
NCBI-ProteinID: XP_018428195
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MDMSSSAPAPLRGPGRPQGLPVVKALFSREADTASALSPVTNLALNMNQLAVLGSQCETP
KRKLFDRYALPRTHSADSMDAGLGLDSPSSMSLRDLEETFEKAMFDSGRCVNAKLPLGRR
RSMPQSGFSFRRNLSESMDCELFHLSDSENKENEPFQFKLPVRPRGTVRSRLHASGKEAL
VHRQKSAPACMFSSPVKDFEIRSCDLPFVRKSSCTSTSTESSDDGFLDMLDGDDTETEPE
IPLGVASLLTAPLVIRRMGPCYEAESPLSRPTLKRTERAQGDVPDKIKRRRSMFEVTDDH
DAERTAHLARSQSFSRETIENIFDSDQRDLIGDFSQVFLFPTVSGKHQELRYITPEMMIK
ISNGHYDPFIERCVIIDCRYPYEYDGGHIKGAINLHMEQELQDYLLKSPIQSHGSKRVVV
IFHCEFSSERGPRMCKFLREKDRDQNEYPNLYYPELYILEGGYKDFYAKFKSYCEPQSYR
PMLHEDFREDLRKFRMKSRTWAGERSKRELYSRLKKL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggacatgtcaagctcggccccagctccgctccggggccccggccgcccccaggggctc
cccgtggtcaaggctctgttctcccgcgaggctgacaccgcctctgccctgtctccagtc
accaacctggcacttaacatgaaccagctggcagtcctgggcagccaatgtgaaactccg
aaacgcaagctgtttgatcgctacgccctccccaggacgcactccgcggactccatggat
gcaggtctgggtctggattcaccgtcttcaatgagtttaagagacctggaagaaacgttc
gaaaaggcgatgtttgactctggccgatgcgtgaatgccaagctgcctctcgggagaagg
agatccatgccgcaaagcggcttctcttttcggcggaacctgtcggaatcgatggactgt
gaattgtttcatctgagtgactcggaaaacaaagaaaatgagcccttccagttcaagctg
ccagtaagacccagaggcactgtgcgctcacggttgcatgccagtgggaaggaggctctg
gtgcacaggcagaagtcggctccggcatgtatgttttcttcacctgtgaaggattttgag
attcgatcttgtgatttgccattcgtaaggaaatcttcctgcacttccaccagtactgag
agcagtgatgatggcttcctggatatgctggatggagacgatacagagacagagccggag
atccctctcggcgttgccagtctcctgacggctccccttgttataagacgcatggggccg
tgttatgaggccgaatcccctctgtccagacctacgctgaagaggacggagagggcacag
ggagacgtgccggataaaatcaagaggcggcgcagcatgtttgaggtgacggatgaccat
gacgctgaaaggactgcgcacctggcccgctcgcaatccttctccagagagaccatagaa
aatatatttgacagcgaccaaagggatctgatcggagacttctctcaggtcttcctcttt
cccaccgtgagcgggaaacaccaagagctacggtacatcaccccggagatgatgataaag
atatcaaatgggcactatgaccctttcattgagcgatgtgtcatcattgactgcagatac
ccctacgagtatgatggcggtcacataaagggtgccatcaacctacacatggagcaggag
ctgcaagactacctgctgaagagccccatccaatctcacggctctaagcgagtggtagtg
atcttccactgcgagttctcctccgagcgggggccgcgaatgtgcaagttcctccgtgag
aaggaccgggaccagaacgagtatcccaatctgtactaccccgagctctacatcctggaa
ggaggttacaaggacttctacgccaagtttaagtcgtactgcgagccgcagagctaccgt
cctatgctgcacgaggatttccgggaggacctgcggaaatttcgcatgaaaagccggacc
tgggccggggagaggagcaagcgagagctgtacagtcgcctgaagaagctgtga

DBGET integrated database retrieval system