KEGG   Nanorana parkeri: 108800988
Entry
108800988         CDS       T04897                                 

Gene name
SETD1A
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A
  KO
K11422  [histone H3]-lysine4 N-trimethyltransferase SETD1 [EC:2.1.1.354]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108800988 (SETD1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108800988 (SETD1A)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     108800988 (SETD1A)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108800988 (SETD1A)
   HMT complexes
    COMPASS/SET1 complex
     108800988 (SETD1A)
    COMPASS/SET1 complex (yeast)
     108800988 (SETD1A)
SSDB
Motif
Pfam: N-SET SET RRM_1
Other DBs
NCBI-GeneID: 108800988
NCBI-ProteinID: XP_018428468
LinkDB
Position
Unknown
AA seq 1701 aa
MEPEGDSHRGTGFQWRSYKLLLDPALPGTRTSQKIYRYDGIHFNVTDGPFLPLGDVRDPR
PQRMWSKPREVSLPIPKFKYDKFYIGQLPQKEVTFAHLNDNIREPFLTDMCRKFGNVEEV
EILLHPETRKHLGLAKVLFSSSRSAKETVAHLHNTTVMGNIVHAELDLLGQQRKKYYDLI
VSGSYNPLTVPTSGRWAQERLQPEQADGRRRLSSDTTLLPGNGTPSSQDSGSLYNQYTPT
LSSQGTPYTPRSGTPYSQDSAYSSRQSTPSHSSTHDTSGYKSRRPENSSGDSYSRRSGHH
YSSASSSSSQHDSSYRRHHRHQHRTSPQSYRSRHRKPPPPPEEPPLHRFPGTPPLPTPPP
LPPDDPQIDRDYRLHPPLPPSPPSSSLLQPPPPPTESWEPPPPPPPLPACSPPPSPARSC
SPLPDGVSESLPFTQHSSSLDSRIEALLKEQRSKFSFLPSDTEEEDEGTADGATQESTVH
EEVPPPLPTHGPYTPPPPASFEDVSAEAFLRFGDVSRTANGQERLSSGEDMEISDEEMAV
DMPGAAGPPYPLLPHLTGPTGGYPAQHLPSPLLQLPPHPHHQAPNSYPLLPNTSARGHPP
TPPPLDPSSSSATAAPHIYDFVNSMELVNRLGNQWGGTSMSFQMQTQMLSRLQQNRQSKG
QPYEDPYIPPLIPHQLPHRHRQQHPPPLMSEQVFAGVYPLFPTQQIQPLLPLQELPIRNN
RALGQELRPLGWGQESGVDPHATTITSVLSALIQEMKSTMQRDLNRKMVENVAFRAFDEW
WERKEEKAKPFQSVAKPVVREEDKEKTRPKEPGLLSLVDWAKSGGAEGFGFGTGLREAMR
LPSFKVKRKHPSEDDDDDSEQKRPRPSTPAEEEEDGRGKETPSEPRPGVKPPQREGARGK
HKRRSPFHLDSEGEEASEESASDKDDDDDDDDDEISSKDEDSEGETTPLAKLSNKIASDS
DSSSDEDSSSSSSSSSSSSSSSSSSPASSDDEEDQEDETLVAPTIPEPFRPPSPPGPPPP
EPVEEKEESRDASPSPPVKQEAYIEAPPQQSPPQSLPITPTKPCTPPSPPLPLLPPPKKR
RKTVTFLLSPEDEPEPAESKPPNHVVTEKLPPEILEKAQEEPLLEPMPPAEEPPPTPPKA
PSAIQPPETLVSPKTEPVLVPPPPAKEPSPQKTPPEQLTVLNLPWDHACLVKSNPPRVGE
QVTPPDGEDMLDDEYDQVDEVKPALPELPHKPEPTAASVQEPLEPERTENLEELLFAPVR
QILLEHSYAQIPASLKQPPKRQRGVSIDLEKPSDFLHVDLGQPVLEAPEEVICVGGGLVP
GLEARTGLLEVGDLHLSSPRKAEEAATKAHHEDSKRKSRKQQQAKEMIEPGEVTSDEDED
EDEEEFWVTTRELRSHKNRRPLKPPSPPKYEVRSEFEQMTILYDIWNNGLDVEDMYFLRE
TYERLLQEDHSTDWLNDTHWVPHTITNIADPKRKRNKQDGLREHQTGCARSEGYYVISKK
DKEKYMNVIPVSVRELDSDMQGTNRVLSERRSEQRRLLNAIGSFSILDSDLLKLNQLKFR
KKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQVVADMREKRYAQQGIGSSYLFR
VDQDTIIDATKCGNLARFINHCCSPNCYAKVITIESQKKIVIYSKQAINVNEEITYDYKF
PIEESKIPCLCGTENCRGTLN
NT seq 5106 nt   +upstreamnt  +downstreamnt
atggagcctgagggcgacagtcacagaggaaccggcttccagtggaggagctacaaactt
cttctggatcctgctcttccagggacacggaccagtcagaagatttaccgctacgatggc
atacacttcaacgtcaccgatggaccatttcttccactgggagatgtacgggatcctcgg
ccacaacgtatgtggagtaaaccaagagaagtgtcgcttcctattccgaaattcaagtat
gataagttctacattggacagctcccccagaaagaggtcacttttgcccacctgaacgac
aacatccgcgagcccttcctgaccgacatgtgccgcaaatttgggaacgtcgaggaggtg
gagatcttgctgcatccggagacgcgtaaacacctcggcctggccaaggttctgttttcc
agctcgcgctcagcaaaggagaccgtcgctcaccttcacaacacgaccgtcatgggtaac
atcgtacacgcagagctcgacctgctaggtcaacagcggaaaaaatattacgatttgatt
gtgagcggctcgtacaaccccctgaccgttcccaccagtgggaggtgggcgcaagagagg
ctgcagcccgaacaggctgacggccgaaggcgcttgtccagcgacaccactcttctacct
ggaaacggaaccccgtcgtctcaagattccggatctctgtacaaccagtacacgccgacc
ctgtcctcgcagggcaccccgtacactcccaggtccggtaccccctactctcaggactcc
gcctattccagcaggcagagtacccccagccattccagtacccatgacacctcaggatac
aagtcacggcgaccggagaacagctctggcgactcttattcacgacgctctggacaccac
tactcttcagcttcctcatcttcctcgcagcacgacagcagctaccgccgacaccacaga
caccaacatcgaacctccccacagtcctaccggtcacgccaccggaaaccgcccccgcct
ccagaggaacctcctttacaccgatttcctgggactcctcccctgcctacacctccgcca
ctcccaccagacgatcctcaaatcgaccgggactatcgactgcaccctccacttcctccg
tctccaccatcttcctctctactgcagcccccgccgccacctaccgagagctgggagccg
cctcctccacctcccccactcccggcctgttctcctcccccgtccccagcgcgttcctgc
tccccgctcccggacggcgtttcggagagcctaccgttcacacaacacagcagcagtctg
gactctcgtatcgaggctcttctaaaggaacagcgctccaaattctccttcctgccttct
gacacggaggaggaggatgagggaacggcggatggggccacacaggagagcacggtccac
gaggaggttccccctccattgcccacgcacgggccatacactccccctccacctgccagc
ttcgaggatgtgtcagccgaggccttcctgaggttcggagatgttagtaggacagccaac
ggacaggaacggttgtcatcaggagaagatatggaaatttcggatgaagaaatggctgtt
gacatgccaggagctgcaggtccgccttacccacttctgcctcatctaacgggacctaca
ggaggttacccggcacaacaccttccttctccccttttacagttaccgccccacccgcat
caccaagcccccaattcctacccgctcctgcccaacacttctgccaggggtcatccgccc
acccctccgcccctcgacccttcatcgtcctcggccactgccgctcctcatatctatgac
tttgtgaactccatggagctggtgaacaggctgggcaaccagtggggcggaacttccatg
tccttccagatgcagactcagatgctgagccgcctgcagcagaacaggcaaagcaaaggg
cagccgtacgaggacccctacatcccgccattaataccccaccagctgcctcacagacat
cggcaacagcaccccccgccgcttatgtccgagcaggtctttgcaggggtttaccccctt
ttccctacacagcagatccaacccttgttaccactacaggagctacctatcaggaacaac
cgagcactgggacaggaactccggccactgggctgggggcaggagagcggagtggacccg
cacgctaccaccatcacaagtgtgttgtctgctctcatccaggagatgaaaagcactatg
cagagagacttaaaccgaaagatggtggaaaatgtcgccttccgagccttcgacgagtgg
tgggagcgcaaggaggagaaggcaaaaccgttccagagcgtggccaagcctgttgtccgg
gaagaagacaaggaaaagacccgtcctaaagaacctggcctgctctcattggtggattgg
gccaagagcggaggcgctgaaggtttcgggtttggcactggactgcgggaggcaatgagg
cttccgtctttcaaggtcaagaggaagcatccatcggaggatgatgatgacgacagtgaa
cagaagaggccgcggccatccacgccagcagaggaggaagaggatgggcgaggaaaggag
acgccatcagaaccacggccaggagtaaaacctccacagcgggagggcgcacgaggaaaa
cacaaacgcaggagcccattccacctagacagtgagggcgaagaggcctctgaggaatcc
gcatctgataaggatgatgatgatgacgacgatgatgatgaaatcagctcgaaggatgaa
gattctgaaggtgagactaccccactggccaaactctccaacaagatcgcgtcagacagc
gacagctccagcgacgaggacagcagttcgtcgtcgtcctcttcatcctcctcttcctcg
tcgtcttcttcatcccctgcctcctctgatgatgaggaagatcaggaggacgagacccta
gtggctcccacgatacctgaacccttcagacctcccagcccaccaggacctcctcctccg
gaacctgtcgaagagaaagaggagagccgggatgcgtctccatcgccaccagtcaaacag
gaagcgtatatagaagccccgccccaacagtctccaccccagtctcttccaatcacaccc
accaaaccatgcacccctccgtctccgccgctaccacttcttcctccacccaagaagagg
cgaaaaaccgtcaccttcctcctttccccagaagacgagcccgaacctgccgagagcaaa
ccgccaaatcatgtggttaccgagaaactaccccccgagattctagagaaagcacaggag
gagccattgttggaaccgatgccaccggcagaggaacctccaccaactccaccaaaggct
ccttcagcaatacagccgccagagactcttgtgagccccaaaaccgagcctgttctggtc
ccaccaccacctgccaaagagccttcgcctcagaagacaccaccggagcagctaacagta
ttaaacctcccttgggatcatgcctgtctggtgaagtctaacccaccgcgagtcggagaa
caagtcacgccaccagatggagaggatatgttagatgatgagtatgaccaagtggatgag
gtaaaaccggctcttccagaacttccacataaaccagaaccaacggccgcttctgtacaa
gaaccgctagagccagaacgaacggaaaacctagaggaacttctttttgccccggtacgg
cagatcttgctggagcacagttacgcacagatacccgcctcattaaagcagcctcccaag
aggcaacgcggagtgtctatagacttggagaaacccagcgacttcctccatgtcgacctg
ggtcagcctgtgctggaggccccagaggaggtgatttgcgtcggaggtggtttagtccca
ggactggaggccaggacagggctgttggaagttggcgacctccatctgtcgtcacccagg
aaagcagaggaggccgcgaccaaagcacatcatgaggactctaagaggaaaagccgtaag
cagcagcaagcgaaggaaatgatcgagcccggggaggtcacgtccgatgaagacgaggat
gaggacgaagaggaattctgggtgaccactcgggagttgaggtctcacaagaaccggcgt
cctttaaaaccgccttccccgccaaagtacgaggtgcgcagcgaatttgaacagatgacc
atcctttatgacatctggaacaacgggctggatgtagaagacatgtatttcttgagggaa
acctacgagaggctgctgcaagaggaccacagtactgactggctgaacgacacccactgg
gttccccatacaatcaccaacattgccgaccccaagagaaagcggaacaagcaggacggt
ctccgggagcaccagacgggctgtgcgcgcagcgaaggctactatgtcatcagcaagaag
gacaaagaaaaatacatgaatgtgattcctgtgtccgtacgggaactggacagcgacatg
cagggtacaaacagggttctgtctgagcgccgctcggagcagaggcgccttctcaatgcc
atcggctctttctcaatattggacagcgacttgttgaagctcaaccaactgaagttccgt
aagaagaagctccgatttggccgcagccgcattcacgagtggggtctcttcgccatggag
cccatcgccgccgacgagatggtgattgagtacgttgggcaaaacatccgtcaggtggtg
gcggacatgcgggagaagaggtacgctcagcaagggatcggaagcagctacttgttccgt
gtggaccaggacaccatcatagacgccaccaaatgtggcaacctggccagattcataaac
cactgctgctcgcctaattgttacgccaaagtcatcaccatcgagtcccaaaagaagatc
gtcatctactccaagcaagcgatcaacgtcaacgaggagatcacgtacgactacaagttc
cccatcgaagaaagcaagattccctgtttatgtgggacggaaaactgccgagggacttta
aattaa

DBGET integrated database retrieval system