KEGG   Nanorana parkeri: 108801680
Entry
108801680         CDS       T04897                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
npr  Nanorana parkeri
Pathway
npr00220  Arginine biosynthesis
npr00330  Arginine and proline metabolism
npr01100  Metabolic pathways
npr04020  Calcium signaling pathway
npr04146  Peroxisome
npr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108801680 (NOS2)
   00330 Arginine and proline metabolism
    108801680 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108801680 (NOS2)
   04020 Calcium signaling pathway
    108801680 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108801680 (NOS2)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     108801680 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 108801680
NCBI-ProteinID: XP_018429088
LinkDB
Position
Unknown
AA seq 1138 aa
MMCPWKLFMKSGNIKDKFAQDSTDLNNNLSKERKQHCSSLKQEDASINGPPKDMAQIKVT
LENKVPENHKNSCKKESFPRYRKLKNYENGKILQDTLHLKAKQKLGCQSSVCHGSVMNPK
CYIRGPRDKPVSQDVVLPQAIEFINQYYDSFKEPQIENYLNRLETISKDIEQTGTYQLTM
EELIFAAKQAWRNAPRCVGRIQWNNLQVFDARTCKTVKDMFELICRHIKFATNGGNIRSA
ITIFPQRTDGKHDFRVWNSQLIRYAGFEMPDGIVIGDPASVEFTELCIQLGWKPRYERFE
ILPLVLQANGEDPELFEIPKDLICEVIMEHPRFEWFKELNLRWYTLPAVSNMLLEVGGIE
FPACPFNGWYMGTEIGVRDFCDVQRYNLLEEVGRRMGLETNKLASLWKDQAVVELNVAVL
YSFQKQNVTIMDHHSAAESFIKHMDNEYKLRGGCPADWVWIVPPVSGSITTVFHQEMLNY
ILSPFYYYQIDAWKTHVWHDERRKPKKKEFKLSVIAKAVFFASTLARKSMAARMKATILY
ATETGKSETFARKLQTLFSFAFNAKVICMEDYNVSNLDKETLLLVVTSTFGNGGCPGNGE
KFKKSLFNMKQLHSKVRYAVFGLGSSMYPQFCAFAHTMDQKLSQLGASQISLTGEGDELN
GQEESFLSWAVHTFTVACEAFKIRDRQNIILPKCYTSTETWNAENYRLVKETQPLDYTKA
LSKLHSRNILKMKLKSRQNLLSDESGRATLLVKLSSENYQDVQYLPGEHVGVFPGNQPDL
VTSIIKLLKDVPSNNQDIRLETRSQQGNFWTVSEKIPPCSLFQALTFFVDITTPPSQLLL
KKLSLLAADAKDKQRLEDLSNDIKKYNEWKSYNYPSFLEVLEEFASLEVPAIFVLTQLPP
LKARYYSISSSKDMKPGEIHLTVAVVDYKTKGGQGPLHHGVCSTWFNSISPNELVPCFIR
STNTFHLPDSPSTPCILIGPGTGISPFRAFWQQRLYDLENKGSQGGSMILLSGCQQSTDE
IYKEEKEYMKSRGILKDVFTAYSQQPGQDKTYVQDILRKHLVDDVIRIVFKEEGHIYICG
NIEMARDVGKTIKMIIAMKKGLNEEEAENYISQLKHQMRYHEDIFGAGYKHLQLQNGA
NT seq 3417 nt   +upstreamnt  +downstreamnt
atgatgtgcccatggaagctgttcatgaaatccgggaacattaaggataaatttgcacaa
gactcgacagacttaaacaacaatctttcaaaagagagaaaacaacattgcagttcttta
aaacaggaggatgccagcatcaatggcccgcctaaagatatggctcaaattaaagttact
ttagagaataaagttccagaaaaccataagaattcttgtaaaaaagaaagttttccaaga
tacaggaagctaaaaaactatgaaaatggaaagattctacaggatactttacacctcaaa
gctaaacagaaacttggctgccaatcatcagtctgtcatggatcagttatgaaccctaag
tgctatataagaggtccaagagacaagccagtgtcacaggatgttgttttacctcaagca
atagagtttataaaccaatattacgattcatttaaagagccacagatagaaaattatctg
aacagactagaaaccattagcaaggatattgaacaaactggaacataccaactaactatg
gaagagctaatctttgctgctaaacaggcatggagaaatgcccctaggtgcgtaggccgg
attcagtggaacaatttacaggtgtttgatgcccgaacatgcaagacagttaaagatatg
tttgagcttatttgtcgtcacataaagtttgccacaaatggtggaaatataaggtcagca
attactatatttcctcagaggactgatgggaaacatgactttcgcgtctggaacagccag
ctaatccgttatgcagggtttgaaatgccagatgggattgtcattggggatccagccagt
gtggagttcacagagctctgtatacaacttggatggaaaccaagatatgaacgctttgag
attcttcccttggtgctgcaggcaaatggcgaagacccagaattatttgaaattccaaaa
gatcttatatgtgaagttataatggagcaccctaggtttgagtggtttaaggaactgaat
ttaaggtggtataccttgcctgcagtttccaacatgctgcttgaagttggaggcattgaa
tttccagcttgtcccttcaatggatggtacatgggtacagaaattggtgttcgggatttt
tgtgatgttcagcgttacaatttgctagaggaagttggaagaagaatgggattagaaact
aacaaactggcatccctgtggaaagaccaggcagtagttgaactcaatgtagctgttctt
tacagcttccagaaacagaatgtaactataatggatcaccattctgcagcagagtctttc
atcaaacacatggataatgaatacaagctgcggggaggctgcccagcggactgggtttgg
attgtgcctccagtgtcagggagcatcaccactgtgtttcaccaggaaatgctcaactat
attctgagccctttttactactatcagattgatgcctggaaaacgcacgtgtggcatgac
gaaaggcgaaaacctaagaagaaagaattcaagctcagtgttattgccaaggctgtgttc
tttgcttcaacacttgcgaggaaatctatggctgccaggatgaaggccacaatcctgtat
gccacagagacgggaaaatcagagacatttgcaagaaaattgcagacattattcagcttt
gctttcaatgctaaggttatctgcatggaagattacaatgtcagcaatctagacaaagaa
actctccttctagtagttacaagtacttttggaaatggcggctgccctggtaatggtgag
aaattcaagaaatcattgtttaatatgaaacaactccacagcaaagtaaggtacgcagtt
tttggacttggctccagcatgtatccacaattttgtgcttttgcccataccatggaccag
aagttgtcacagcttggtgcctcccagattagcctaactggtgaaggggatgagcttaat
ggacaagaagaatcttttttatcatgggctgttcacacttttacggttgcttgtgaagca
ttcaagattagagacagacaaaacattatactgccaaaatgttatacgtcaactgaaacc
tggaatgcagaaaactatcgtctggtgaaagaaactcagcctttagattacaccaaagcg
ctctccaaactgcattcaagaaatatcctgaaaatgaagctaaaatcaaggcagaatttg
ctaagtgatgaatctggacgtgccactctactagtgaaactttctagtgagaattaccag
gatgttcagtatctgccaggggaacatgttggtgtgtttcctggcaaccagccagatcta
gttaccagcataattaaacttctgaaggatgttccctccaacaatcaggacatccgactg
gagacacgcagccaacagggtaacttctggacagtcagtgagaaaatccctccttgctct
ctgttccaagctttgactttttttgtagacataactactccaccctcccagctacttctg
aaaaagctgtcactgctggctgctgatgcaaaggataaacagagactggaagacttgagc
aatgacataaaaaaatataatgaatggaagtcctacaactacccatcatttcttgaggta
ctggaagagtttgcatctctggaggtgcctgctatatttgtattaactcagctcccacca
ctgaaggcacgatactactctataagctcttcaaaggatatgaaacctggggagatccat
ctgacagtggctgttgttgactacaaaacaaaaggaggtcaaggtcctctgcaccatggt
gtgtgcagtacatggttcaatagcatcagtcctaatgaactggttccttgttttataaga
agcacaaacacattccatctcccagacagcccttccactccctgcattctgattggtcca
ggtacaggaatttcaccattcagagcattctggcaacaaagattatatgatctggaaaat
aaaggatcacagggaggctcaatgatactgctgtctggttgccagcaatccactgatgaa
atctacaaagaagaaaaggaatacatgaaaagcagaggcattttaaaagatgtatttact
gcatattcccagcaaccagggcaagataagacctatgttcaggacattctgaggaagcac
cttgtggatgatgtcatcaggattgtcttcaaagaagaaggacacatttatatttgtgga
aacattgagatggccagagatgtgggaaaaacaattaaaatgattattgcaatgaagaag
ggactgaatgaggaggaagcagaaaactatatttcccagctaaagcatcaaatgcgttat
catgaagatatatttggagcaggctacaaacatctacaacttcagaatggagcctga

DBGET integrated database retrieval system