KEGG   Nanorana parkeri: 108801693
Entry
108801693         CDS       T04897                                 

Gene name
PRDM8
Definition
(RefSeq) PR domain zinc finger protein 8
  KO
K20797  PR domain zinc finger protein 8 [EC:2.1.1.-]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108801693 (PRDM8)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     108801693 (PRDM8)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108801693 (PRDM8)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-C2H2_2 zf-H2C2_2 SET zf-C2H2_6 DUF5810 zf-C2H2_9
Other DBs
NCBI-GeneID: 108801693
NCBI-ProteinID: XP_018429098
LinkDB
Position
Unknown
AA seq 590 aa
MSVMEDTGVQKAIWDGDAKAVQQCLTDIFTSVYTTCDIPENAIFGPCVLSHTSLYDSIAF
IALKSTDKRTVPYIFRVDTSAANGSSEGLMWLRLVQSARNKEEQNLEAYIKNGQLFYRSL
RRISKDEELLVWYGKELIDLLLLNPGRTQGKTAGSSQSTCLECNQRFQYDFPYAAHVRFR
CPKRLHTLDSNSEQPGKDTRELESRNAMISPAKYNKISIYQPQKENHKPTTDFHNLAREI
ENFRGPSSSFGSSPSPKSNLLRQDSENTTESLHKTKRKYDDHLDDVRAKRIDPSGRFLDR
PMPSSKEDLVCSPQPFRGNSYFNVDEGGQLYAPPSPETGDAKRSAFVEVKKASRGVEESN
PSTDGKDVSPAHASSQSEDKRLHARPENQSGGSPMGSAFTSVAQVSNPEQERKSAFSQPT
RSSFSHVTPLQVMGQKLVSSGVSMDCHPESVGPARLYQTDPLSVKLSSPELNGNCALPGS
LPKQSPFLFATTFWPKSSPAPLQMQLPSTLTLLPPSFTSLCLPAQNWCAKCNASFRMTSD
LVYHMRSHHKKEYAMEPLVKRRREEKLKCPICNESFRERHHLSRHMTSHN
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgtcagtcatggaagacactggcgttcaaaaagcaatttgggatggggatgccaaagct
gtccagcaatgtctgacggatatatttacaagcgtctacaccacgtgtgacatcccagaa
aatgcaatctttggtccctgcgtgctgagtcacacttcactgtatgacagtatagcattt
atcgctctcaaatctaccgataagaggacagtaccctacatattccgggtggacacttca
gctgcgaacggctcctccgagggactgatgtggctccgtctggttcagtctgctagaaac
aaagaggaacaaaatctggaagcctacatcaaaaatgggcaactgttctacagatccctt
cgcaggatttccaaagacgaggagctgttagtttggtacgggaaggaactgatagatctg
cttcttctgaaccctggcaggacccaaggaaaaactgcgggatcatctcagtccacctgt
ttggagtgtaaccagaggtttcagtatgatttcccctatgcagctcatgtgagatttcga
tgtcccaagagactccacacgttggattccaactcagagcagccgggcaaggacactaga
gagctagagtctcgaaacgccatgatctctccagccaaatacaacaaaatatcaatttat
cagccgcagaaagagaatcacaagcccaccacagactttcataacttggccagggaaatt
gagaattttaggggcccttcatcgtcattcggttcttctccttcgcccaaatcgaatctc
ttacgacaggactctgagaacaccaccgagagtctccataaaaccaaaagaaaatatgat
gaccacctggatgacgtcagagccaagaggattgacccatctgggagatttctggacagg
ccaatgccttcctccaaagaggatttggtgtgcagccctcagccatttagagggaactct
tacttcaatgtcgatgaaggcggacagttatatgctcctccgagcccagagactggagac
gccaagagaagcgcttttgtagaagtaaaaaaggcatcaagaggagttgaagagagtaac
ccaagcacagatggtaaagatgtgtctcctgcccatgccagcagtcaaagcgaagacaag
agactacacgccaggccagaaaatcagtcagggggcagccccatgggcagtgcatttact
agtgtcgcccaggtgtcaaaccctgagcaggagagaaaaagtgctttttctcaacccacc
aggagcagcttcagccatgtaacccctttgcaggtgatgggacaaaaactggtatctagt
ggggtaagcatggattgccacccagagagcgttgggccagcaaggctgtatcagactgat
cccctctcagtcaagctgtcaagccctgaattaaatgggaactgcgcacttccaggaagc
ttgccaaagcaaagtcctttcctctttgccactacgttttggccaaagagctcacctgcc
cctctacagatgcagctgccttctacgcttaccctattgcctccttcattcacctcttta
tgcctgccagctcaaaactggtgtgccaaatgcaacgcttctttcaggatgacctcggac
ctagtgtatcacatgaggtcccaccacaaaaaggagtacgccatggaacccctggtgaag
aggaggagagaggagaaactcaagtgccccatatgcaacgagtcctttagggaacgccac
cacctatccaggcacatgacctctcacaactga

DBGET integrated database retrieval system